PDB entry 3o1w

View 3o1w on RCSB PDB site
Description: Crystal structure of dimeric KlHxk1 in crystal form III
Class: transferase
Keywords: rnaseh-like fold, hexokinase, glycolysis, glucose repression, ATP binding, mig1 binding, transferase
Deposited on 2010-07-22, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.162
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexokinase
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: KLLA0D11352g, RAG5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o1wa1, d3o1wa2
  • Chain 'B':
    Compound: hexokinase
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: KLLA0D11352g, RAG5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o1wb1, d3o1wb2
  • Heterogens: GOL, NHE, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o1wA (A:)
    mvrlgpkkpparkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkg
    gnipmipgwvveyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrt
    gtseqlwsfiakclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdie
    gveghdvvpmlqeqieklnipinvvalindttgtlvaslytdpqtkmgiiigtgvngayy
    dvvsgieklegllpedigpdspmainceygsfdnehlvlprtkydviideesprpgqqaf
    ekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdtsypskieddpfenledt
    ddlfktnlniettvverklirklaelvgtraarltvcgvsaicdkrgyktahiaadgsvf
    nrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvgaaiiacltqkrlaagksv
    gikge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1wA (A:)
    vrlgpkkpparkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkgg
    nipmipgwvveyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtg
    tseqlwsfiakclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdieg
    veghdvvpmlqeqieklnipinvvalindttgtlvaslytdpqtkmgiiigtgvngayyd
    vvsgieklegllpedigpdspmainceygsfdnehlvlprtkydviideesprpgqqafe
    kmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdtsypskieddpfenledtd
    dlfktnlniettvverklirklaelvgtraarltvcgvsaicdkrgyktahiaadgsvfn
    rypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvgaaiiacltqkrlaagksvg
    ikge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o1wB (B:)
    mvrlgpkkpparkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkg
    gnipmipgwvveyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrt
    gtseqlwsfiakclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdie
    gveghdvvpmlqeqieklnipinvvalindttgtlvaslytdpqtkmgiiigtgvngayy
    dvvsgieklegllpedigpdspmainceygsfdnehlvlprtkydviideesprpgqqaf
    ekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdtsypskieddpfenledt
    ddlfktnlniettvverklirklaelvgtraarltvcgvsaicdkrgyktahiaadgsvf
    nrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvgaaiiacltqkrlaagksv
    gikge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1wB (B:)
    vrlgpkkpparkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkgg
    nipmipgwvveyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtg
    tseqlwsfiakclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdieg
    veghdvvpmlqeqieklnipinvvalindttgtlvaslytdpqtkmgiiigtgvngayyd
    vvsgieklegllpedigpdspmainceygsfdnehlvlprtkydviideesprpgqqafe
    kmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdtsypskieddpfenledtd
    dlfktnlniettvverklirklaelvgtraarltvcgvsaicdkrgyktahiaadgsvfn
    rypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvgaaiiacltqkrlaagksvg
    ikge