PDB entry 3o1s

View 3o1s on RCSB PDB site
Description: Iron-Catalyzed Oxidation Intermediates Captured in A DNA Repair Dioxygenase
Class: oxidoreductase
Keywords: Demethylase, OXIDOREDUCTASE
Deposited on 2010-07-22, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ketoglutarate-dependent dioxygenase AlkB
    Species: Escherichia coli [TaxId:83333]
    Gene: alkB, aidD, b2212, JW2200
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05050
      • engineered mutation (118)
    Domains in SCOPe 2.07: d3o1sa_
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*gp*tp*ap*ap*(mdq)p*ap*cp*cp*gp*t)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*cp*gp*gp*tp*ap*tp*tp*ap*cp*cp*t)-3')
    Species: synthetic, synthetic
  • Heterogens: FE, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o1sA (A:)
    mqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwt
    thrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklcl
    hqdkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiq
    plkagfhpltidcrynltfrqagkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1sA (A:)
    eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
    rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhq
    dkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
    kagfhpltidcrynltfrqagk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.