PDB entry 3o1q

View 3o1q on RCSB PDB site
Description: Native Crystal Structure of Helicobacter pylori Urease Accessory Protein UreF
Deposited on 2010-07-21, released 2010-08-18
The last revision was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.17
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease accessory protein ureF
    Species: Helicobacter pylori [TaxId:210]
    Gene: ureF, HP_0069
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Urease accessory protein ureF
    Species: Helicobacter pylori [TaxId:210]
    Gene: ureF, HP_0069
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Urease accessory protein ureF
    Species: Helicobacter pylori [TaxId:210]
    Gene: ureF, HP_0069
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o1qA (A:)
    mdkgksvksteksvgmppktpktdnnahvdneflilqvndavfpigsythsfgletyiqq
    kkvtnkesaleylkanlssqflytemlslkltyesalqqdlkkilgveevimlstspmel
    rlanqklgnrfiktlqamneldmgeffnayaqktkdpthatsygvfaaslgielkkalrh
    ylyaqtsnmvincvksvplsqndgqkillslqspfnqliektleldeshlctasvqndik
    amqheslysrlyms
    

    Sequence, based on observed residues (ATOM records):
    >3o1qA (A:)
    dnnahvdneflilqvndavfpigsythsfgletyiqqkkvtnkesaleylkanlssqfly
    temlslkltyesalqqdlkkilgveevimlstspmelrlanqklgnrfiktlqamneldm
    geffnayaqktkdpthatsygvfaaslgielkkalrhylyaqtsnmvincvksvplsqnd
    gqkillslqspfnqliektleldeshlcta
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o1qB (B:)
    mdkgksvksteksvgmppktpktdnnahvdneflilqvndavfpigsythsfgletyiqq
    kkvtnkesaleylkanlssqflytemlslkltyesalqqdlkkilgveevimlstspmel
    rlanqklgnrfiktlqamneldmgeffnayaqktkdpthatsygvfaaslgielkkalrh
    ylyaqtsnmvincvksvplsqndgqkillslqspfnqliektleldeshlctasvqndik
    amqheslysrlyms
    

    Sequence, based on observed residues (ATOM records):
    >3o1qB (B:)
    dnnahvdneflilqvndavfpigletyiqqkkvtnkesaleylkanlssqflytemlslk
    ltyesalqqdlkkilgveevimlstspmelrlanqklgnrfiktlqamneldmgeffnay
    aqktkdpthatsygvfaaslgielkkalrhylyaqtsnmvincvksvplsqndgqkills
    lqspfnqliektleldeshlcta
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3o1qC (C:)
    mdkgksvksteksvgmppktpktdnnahvdneflilqvndavfpigsythsfgletyiqq
    kkvtnkesaleylkanlssqflytemlslkltyesalqqdlkkilgveevimlstspmel
    rlanqklgnrfiktlqamneldmgeffnayaqktkdpthatsygvfaaslgielkkalrh
    ylyaqtsnmvincvksvplsqndgqkillslqspfnqliektleldeshlctasvqndik
    amqheslysrlyms
    

    Sequence, based on observed residues (ATOM records):
    >3o1qC (C:)
    dnnahvdneflilqvndavfpigsythsfgletyiqqkkvtnkesaleylkanlssqfly
    temlslkltyesalqqdlkkilgveevimlstspmelrlanqklgnrfiktlqamneldm
    geffnayaqktkdpthatsygvfaaslgielkkalrhylyaqtsnmvincvksvplsqnd
    gqkillslqspfnqliektleldeshlcta