PDB entry 3o1n

View 3o1n on RCSB PDB site
Description: 1.03 Angstrom Crystal Structure of Q236A Mutant Type I Dehydroquinate Dehydratase (aroD) from Salmonella typhimurium
Class: lyase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TIM barrel, dehydratase, LYASE
Deposited on 2010-07-21, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: N/A
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: aroD, STM1358
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58687 (24-275)
      • engineered mutation (259)
    Domains in SCOPe 2.07: d3o1na_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: aroD, STM1358
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58687 (24-275)
      • engineered mutation (259)
    Domains in SCOPe 2.07: d3o1nb_
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o1nA (A:)
    mhhhhhhssgvdlgtenlyfqsnamktvtvrdlvvgegapkiivslmgktitdvkseala
    yreadfdilewrvdhfanvttaesvleaagaireiitdkpllftfrsakeggeqalttgq
    yidlnraavdsglvdmidlelftgddevkatvgyahqhnvavimsnhdfhktpaaeeivq
    rlrkmqelgadipkiavmpqtkadvltlltatvemqeryadrpiitmsmsktgvisrlag
    evfgsaatfgavkkasapgaisvadlrtvltilhqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1nA (A:)
    mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
    vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
    ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
    vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgaisva
    dlrtvltilhqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o1nB (B:)
    mhhhhhhssgvdlgtenlyfqsnamktvtvrdlvvgegapkiivslmgktitdvkseala
    yreadfdilewrvdhfanvttaesvleaagaireiitdkpllftfrsakeggeqalttgq
    yidlnraavdsglvdmidlelftgddevkatvgyahqhnvavimsnhdfhktpaaeeivq
    rlrkmqelgadipkiavmpqtkadvltlltatvemqeryadrpiitmsmsktgvisrlag
    evfgsaatfgavkkasapgaisvadlrtvltilhqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1nB (B:)
    mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
    vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
    ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
    vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavgaisvadlrtvl
    tilhqa