PDB entry 3o1l

View 3o1l on RCSB PDB site
Description: Crystal structure of a formyltetrahydrofolate deformylase (PSPTO_4314) from Pseudomonas syringae pv. tomato str. DC3000 at 2.20 A resolution
Deposited on 2010-07-21, released 2010-09-15
The last revision was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formyltetrahydrofolate deformylase
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: purU-3, PSPTO4314, PSPTO_4314
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87X74 (19-301)
      • expression tag (4-18)
  • Chain 'B':
    Compound: Formyltetrahydrofolate deformylase
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: purU-3, PSPTO4314, PSPTO_4314
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87X74 (19-301)
      • expression tag (17-18)
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o1lA (A:)
    mgsdkihhhhhhenlyfqgmrtfrlviacpdrvgivakvsnflashngwiteashhsdnl
    sgwffmrheiradtlpfdldgfreaftpiaeefsmdwritdsaqkkrvvlmasreshcla
    dllhrwhsdeldcdiacvisnhqdlrsmvewhdipyyhvpvdpkdkepafaevsrlvghh
    qadvvvlarymqilppqlcreyahqvinihhsflpsfvgakpyhqaslrgvkligatchy
    vteeldagpiieqdvvrvshrdsienmvrfgrdvekmvlarglrahledrvlvhdnktvv
    fd
    

    Sequence, based on observed residues (ATOM records):
    >3o1lA (A:)
    kihhhhhhenlyfqgmrtfrlviacpdrvgivakvsnflashngwiteashhsdnlsgwf
    fmrheiradtlpfdldgfreaftpiaeefsmdwritdsaqkkrvvlmasreshcladllh
    rwhsdeldcdiacvisnhqdlrsmvewhdipyyhvpvdpkdkepafaevsrlvghhqadv
    vvlarymqilppqlcreyahqvinihhsflpsfvgakpyhqaslrgvkligatchyvtee
    ldagpiieqdvvrvshrdsienmvrfgrdvekmvlarglrahledrvlvhdnktvvfd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o1lB (B:)
    mgsdkihhhhhhenlyfqgmrtfrlviacpdrvgivakvsnflashngwiteashhsdnl
    sgwffmrheiradtlpfdldgfreaftpiaeefsmdwritdsaqkkrvvlmasreshcla
    dllhrwhsdeldcdiacvisnhqdlrsmvewhdipyyhvpvdpkdkepafaevsrlvghh
    qadvvvlarymqilppqlcreyahqvinihhsflpsfvgakpyhqaslrgvkligatchy
    vteeldagpiieqdvvrvshrdsienmvrfgrdvekmvlarglrahledrvlvhdnktvv
    fd
    

    Sequence, based on observed residues (ATOM records):
    >3o1lB (B:)
    qgmrtfrlviacpdrvgivakvsnflashngwiteashhsdnlsgwffmrheiradtlpf
    dldgfreaftpiaeefsmdwritdsaqkkrvvlmasreshcladllhrwhsdeldcdiac
    visnhqdlrsmvewhdipyyhvpvdpkdkepafaevsrlvghhqadvvvlarymqilppq
    lcreyahqvinihhsflpsfvgakpyhqaslrgvkligatchyvteeldagpiieqdvvr
    vshrdsienmvrfgrdvekmvlarglrahledrvlvhdnktvvfd