PDB entry 3o1k

View 3o1k on RCSB PDB site
Description: Crystal structure of putative dihydroneopterin aldolase (FolB) from Vibrio cholerae O1 biovar El Tor str. N16961
Class: lyase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, clan THBO-biosyn (CL0334), (PF02152), dihydroneopterin aldolase, FolB, folic acid and derivative metabolic process (GO:0006760), LYASE
Deposited on 2010-07-21, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroneopterin aldolase FolB, putative
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o1ka_
  • Chain 'B':
    Compound: Dihydroneopterin aldolase FolB, putative
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o1kb_
  • Chain 'C':
    Compound: Dihydroneopterin aldolase FolB, putative
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o1kc_
  • Chain 'D':
    Compound: Dihydroneopterin aldolase FolB, putative
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o1kd_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o1kA (A:)
    snamgirpvnrkrlsmdkvfieqlevittigvydweqqikqklvldlemahdnraagksd
    dvadaldyaqvsqavlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqa
    kgvgviierarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1kA (A:)
    smdkvfieqlevittigvydweqqikqklvldlemahdnraagksddvadaldyaqvsqa
    vlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqakgvgviierar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o1kB (B:)
    snamgirpvnrkrlsmdkvfieqlevittigvydweqqikqklvldlemahdnraagksd
    dvadaldyaqvsqavlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqa
    kgvgviierarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1kB (B:)
    lsmdkvfieqlevittigvydweqqikqklvldlemahdnraagksddvadaldyaqvsq
    avlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqakgvgviierar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o1kC (C:)
    snamgirpvnrkrlsmdkvfieqlevittigvydweqqikqklvldlemahdnraagksd
    dvadaldyaqvsqavlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqa
    kgvgviierarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1kC (C:)
    smdkvfieqlevittigvydweqqikqklvldlemahdnraagksddvadaldyaqvsqa
    vlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqakgvgviierar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o1kD (D:)
    snamgirpvnrkrlsmdkvfieqlevittigvydweqqikqklvldlemahdnraagksd
    dvadaldyaqvsqavlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqa
    kgvgviierarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1kD (D:)
    lsmdkvfieqlevittigvydweqqikqklvldlemahdnraagksddvadaldyaqvsq
    avlehieqgrfllvervaeevaelimtrfavpwlrirltkpgavpqakgvgviierar