PDB entry 3o1j

View 3o1j on RCSB PDB site
Description: Crystal Structure of the TorS sensor domain - TorT complex in the absence of isopropanol
Deposited on 2010-07-21, released 2011-12-21
The last revision was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein torS
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: torS, VPA0675
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87ID1 (4-End)
      • expression tag (2-3)
  • Chain 'B':
    Compound: Sensor protein torS
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: torS, VPA0675
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87ID1 (4-End)
      • expression tag (2-3)
  • Chain 'C':
    Compound: Periplasmic protein TorT
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: TorT, VPA0674
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87ID2 (5-303)
      • expression tag (4)
  • Chain 'D':
    Compound: Periplasmic protein TorT
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: TorT, VPA0674
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87ID2 (5-303)
      • expression tag (4)
  • Heterogens: IPA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o1jA (A:)
    gsgsamiearqvselstriissvqmlsnaqneqerkeagrvlfeqlesllthikelgges
    fdsklldalesnvqnvinnlaelgvtverklwlakeidtrveemrllseeleqltrtqvq
    ntstiavanvthiydlleankkdqvyqaldalvevdldlterlhelhllafkmlnqieea
    rtltnvdriqqiqtafennlkimkrrvlavedptrskqmsqlltelgkrqvvftillqqy
    enneqsqqlmqktlelfselnstvnklvddsnktttk
    

    Sequence, based on observed residues (ATOM records):
    >3o1jA (A:)
    gsamiearqvselstriissvqmlsnaqneqerkeagrvlfeqlesllthikelggesfd
    sklldalesnvqnvinnlaelgvtverklwlakeidtrveemrllseeleqltrtqvqnt
    stiavanvthiydlleankkdqvyqaldalvevdldlterlhelhllafkmlnqieeart
    ltnvdriqqiqtafennlkimkrrvlavedptrskqmsqlltelgkrqvvftillqqyen
    neqsqqlmqktlelfselnstvnklvddsnktt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o1jB (B:)
    gsgsamiearqvselstriissvqmlsnaqneqerkeagrvlfeqlesllthikelgges
    fdsklldalesnvqnvinnlaelgvtverklwlakeidtrveemrllseeleqltrtqvq
    ntstiavanvthiydlleankkdqvyqaldalvevdldlterlhelhllafkmlnqieea
    rtltnvdriqqiqtafennlkimkrrvlavedptrskqmsqlltelgkrqvvftillqqy
    enneqsqqlmqktlelfselnstvnklvddsnktttk
    

    Sequence, based on observed residues (ATOM records):
    >3o1jB (B:)
    gsamiearqvselstriissvqmlsnaqneqerkeagrvlfeqlesllthikelggesfd
    sklldalesnvqnvinnlaelgvtverklwlakeidtrveemrllseeleqltrtqvqnt
    stiavanvthiydlleankkdqvyqaldalvevdldlterlhelhllafkmlnqieeart
    ltnvdriqqiqtafennlkimkrrvlavedptrskqmsqlltelgkrqvvftillqqyen
    neqsqqlmqktlelfselnstvnklvddsnktt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3o1jC (C:)
    gsgsdekicaiyphlkdsywlsvnygmvseaekqgvnlrvleaggypnksrqeqqlalct
    qwganaiilgtvdphayehnlkswvgntpvfatvnqldldeeqstllkgevgvdwywmgy
    eagkylaerhpkgsgktnialllgprtrggtkpvttgfyeaiknsdihivdsfwadndke
    lqrnlvqrvidmgnidyivgsavaieaaiselrsadkthdiglvsvylshgvyrgllrnk
    vlfaptdkmvqqgrlsvmqaahylrhqpyekqaspiikpltpktlhddtieeslspseyr
    ptfs
    

    Sequence, based on observed residues (ATOM records):
    >3o1jC (C:)
    dekicaiyphlkdsywlsvnygmvseaekqgvnlrvleaggypnksrqeqqlalctqwga
    naiilgtvdphayehnlkswvgntpvfatvnqldldeeqstllkgevgvdwywmgyeagk
    ylaerhpkgsgktnialllgprtkpvttgfyeaiknsdihivdsfwadndkelqrnlvqr
    vidmgnidyivgsavaieaaiselrsadkthdiglvsvylshgvyrgllrnkvlfaptdk
    mvqqgrlsvmqaahylrhqpyekqaspiikpltpktlhddtieeslspseyrptfs
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3o1jD (D:)
    gsgsdekicaiyphlkdsywlsvnygmvseaekqgvnlrvleaggypnksrqeqqlalct
    qwganaiilgtvdphayehnlkswvgntpvfatvnqldldeeqstllkgevgvdwywmgy
    eagkylaerhpkgsgktnialllgprtrggtkpvttgfyeaiknsdihivdsfwadndke
    lqrnlvqrvidmgnidyivgsavaieaaiselrsadkthdiglvsvylshgvyrgllrnk
    vlfaptdkmvqqgrlsvmqaahylrhqpyekqaspiikpltpktlhddtieeslspseyr
    ptfs
    

    Sequence, based on observed residues (ATOM records):
    >3o1jD (D:)
    dekicaiyphlkdsywlsvnygmvseaekqgvnlrvleaggypnksrqeqqlalctqwga
    naiilgtvdphayehnlkswvgntpvfatvnqldldeeqstllkgevgvdwywmgyeagk
    ylaerhpkgsgktnialllgprtkpvttgfyeaiknsdihivdsfwadndkelqrnlvqr
    vidmgnidyivgsavaieaaiselrsadkthdiglvsvylshgvyrgllrnkvlfaptdk
    mvqqgrlsvmqaahylrhqpyekqaspiikpltpktlhddtieeslspseyrptfs