PDB entry 3o1g

View 3o1g on RCSB PDB site
Description: Cathepsin K covalently bound to a 2-cyano pyrimidine inhibitor with a benzyl P3 group.
Class: hydrolase
Keywords: hydrolase, reversible covalent inhibitor, ligand covalently bound to Cys25, bone, K protein from comp
Deposited on 2010-07-21, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.17
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o1ga_
  • Heterogens: SO4, O75, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o1gA (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm