PDB entry 3o1f

View 3o1f on RCSB PDB site
Description: P1 crystal form of E. coli ClpS at 1.4 A resolution
Class: hydrolase
Keywords: adaptor, HYDROLASE
Deposited on 2010-07-21, released 2011-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Escherichia coli [TaxId:562]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o1fa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Escherichia coli [TaxId:562]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3o1fb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o1fA (A:)
    smykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaevaetkv
    amvnkyarenehpllctleka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o1fB (B:)
    smykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaevaetkv
    amvnkyarenehpllctleka