PDB entry 3o1d

View 3o1d on RCSB PDB site
Description: Structure-function study of Gemini derivatives with two different side chains at C-20, Gemini-0072 and Gemini-0097.
Deposited on 2010-07-21, released 2011-07-06
The last revision was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor A
    Species: Danio rerio [TaxId:7955]
    Gene: vdra, nr1i1a, vdr
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PTN2 (4-301)
      • expression tag (2-3)
  • Chain 'B':
    Compound: nuclear receptor coactivator 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: G72, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o1dA (A:)
    gshmlsdeqmqiinslveahhktyddsysdfvrfrppvregpvtrsasraaslhslsdas
    sdsfnhspesvdtklnfsnllmmyqdsgspdsseedqqsrlsmlphladlvsysiqkvig
    fakmipgfrdltaedqiallkssaieiimlrsnqsfsledmswscggpdfkycindvtka
    ghtlelleplvkfqvglkklklheeehvllmaicllspdrpgvqdhvriealqdrlcdvl
    qayiriqhpggrllyakmiqkladlrslneehskqyrslsfqpehsmqltplvlevfgse
    vs
    

    Sequence, based on observed residues (ATOM records):
    >3o1dA (A:)
    hmlsdeqmqiinslveahhktyddsysdfvrfrppvrrlsmlphladlvsysiqkvigfa
    kmipgfrdltaedqiallkssaieiimlrsnqsfsledmswscggpdfkycindvtkagh
    tlelleplvkfqvglkklklheeehvllmaicllspdrpgvqdhvriealqdrlcdvlqa
    yiriqhpggrllyakmiqkladlrslneehskqyrslsfqpehsmqltplvlevfgsevs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o1dB (B:)
    khkilhrllqdss
    

    Sequence, based on observed residues (ATOM records):
    >3o1dB (B:)
    khkilhrllq