PDB entry 3o1c

View 3o1c on RCSB PDB site
Description: High resolution crystal structure of histidine triad nucleotide-binding protein 1 (Hint1) C38A mutant from rabbit complexed with Adenosine
Class: hydrolase
Keywords: hydrolase, hint protein, hit protein, adenosine 5'-monophosphoramidase
Deposited on 2010-07-21, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine triad nucleotide-binding protein 1
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: HINT1, HINT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80912 (Start-125)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d3o1ca_
  • Heterogens: ADN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o1cA (A:)
    madeiakaqvarpggdtifgkiirkeipakiifeddqalafhdispqapthflvipkkhi
    sqisaaedadesllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrq
    mnwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1cA (A:)
    rpggdtifgkiirkeipakiifeddqalafhdispqapthflvipkkhisqisaaedade
    sllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg