PDB entry 3o1a

View 3o1a on RCSB PDB site
Description: Structure of OxyE (CYP165D3), a Cytochrome P450 Involved in Teicoplanin Biosynthesis
Class: oxidoreductase
Keywords: Cytochrome P450 Fold, Phenolic Coupling Enzyme, tcp12 PCP domain, ANTIBIOTIC BIOSYNTHESIS, Oxidoreductase
Deposited on 2010-07-21, released 2010-11-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxy protein
    Species: Actinoplanes teichomyceticus [TaxId:1867]
    Gene: tcp18, tcp19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3o1aa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o1aA (A:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftmalplphqrlrldpvpefeelqkagpl
    heydtepgmdgrkqwlvtghdevrailadherfssmrpvddeadrallpgilqaydppdh
    trlrrtvapaysarrmerlrprieeiveeclddfesvgapvdfvrhaawpipayiacefl
    gvprddqaelsrmiresresrlprqrtlsglgivnytkrltsgkrrdpgdgmigvivreh
    gaeisdeelaglaegnlimaaeqmaaqlavavlllvthpdqmallrekpelidsateevl
    rhasiveapaprvaladvrmagrdihagdvltcsmlatnrapgdrfditrekathmafgh
    gihhcigaplarlqlrvalpavvgrfpslrlavpeedlrfkpgrpapfaveelplew
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o1aA (A:)
    alplphqrlrldpvpefeelqkagplheydtepgmdgrkqwlvtghdevrailadherfs
    smrpvddeadrallpgilqaydppdhtrlrrtvapaysarrmerlrprieeiveeclddf
    esvgapvdfvrhaawpipayiaceflgvprddqaelsrmiresresrlprqrtlsglgiv
    nytkrltsgkrrdpgdgmigvivrehgaeisdeelaglaegnlimaaeqmaaqlavavll
    lvthpdqmallrekpelidsateevlrhasiveapaprvaladvrmagrdihagdvltcs
    mlatnrapgdrfditrekathmafghgihhcigaplarlqlrvalpavvgrfpslrlavp
    eedlrfkpgrpapfaveelplew