PDB entry 3o18

View 3o18 on RCSB PDB site
Description: Crystal structure of c-phycocyanin from Themosynechococcus vulcanus at 1.35 angstroms resolution
Class: photosynthesis
Keywords: Phycobilisome, Photosynthesis, Light Harvesting, Cyanobacteria
Deposited on 2010-07-21, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.21
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-phycocyanin alpha subunit
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o18a_
  • Chain 'B':
    Compound: c-phycocyanin beta subunit
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o18b_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o18A (A:)
    mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
    qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
    tfdlspswyiealkyikanhgltgqaaveanayidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o18B (B:)
    mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
    aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
    gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava