PDB entry 3o15

View 3o15 on RCSB PDB site
Description: Crystal Structure of Bacillus subtilis Thiamin Phosphate Synthase Complexed with a Carboxylated Thiazole Phosphate
Class: transferase
Keywords: thiamin biosynthesis, TIM barrel, protein-intermediate complex, Transferase
Deposited on 2010-07-20, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine-phosphate pyrophosphorylase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: thiE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o15a_
  • Heterogens: 3NM, IFP, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o15A (A:)
    mrgshhhhhhgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfre
    kggdaltgearikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevra
    aigdmilgvsahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgis
    ipivgiggitidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o15A (A:)
    trisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearikf
    aekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvsahtm
    sevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggitidna
    apviqagadgvsmisaisqaedpesaarkfreeiqtykt