PDB entry 3o14

View 3o14 on RCSB PDB site
Description: crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution
Deposited on 2010-07-20, released 2010-09-08
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-ECFsigma factor, ChrR
    Species: Marinobacter aquaeolei [TaxId:351348]
    Gene: Maqu_0586
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1TY68 (1-End)
      • leader sequence (0)
  • Chain 'B':
    Compound: Anti-ECFsigma factor, ChrR
    Species: Marinobacter aquaeolei [TaxId:351348]
    Gene: Maqu_0586
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1TY68 (1-End)
      • leader sequence (0)
  • Heterogens: ZN, NIO, SO4, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o14A (A:)
    gmeinadftkpvvidtdqlewrpspmkgverrmldriggevaratsivryapgsrfsaht
    hdggeefivldgvfqdehgdypagtyvrnppttshvpgsaegctifvklwqfdpadrtqf
    sknmeaelgapvegistsllhederetvthrklepganltseaaggievlvldgdvtvnd
    evlgrnawlrlpegealsatagargakiwmktghlrfvrtpev
    

    Sequence, based on observed residues (ATOM records):
    >3o14A (A:)
    gmeinadftkpvvidtdqlewrpspmkgverrmldriggevaratsivryapgsrfsaht
    hdggeefivldgvfqdehgdypagtyvrnppttshvpgsaegctifvklwqfdpadrtqf
    sknmeaelgapvegistsllhederetvthrklepganltseaaggievlvldgdvtvnd
    evlgrnawlrlpegealsatagargakiwmktghlrfvrtpe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o14B (B:)
    gmeinadftkpvvidtdqlewrpspmkgverrmldriggevaratsivryapgsrfsaht
    hdggeefivldgvfqdehgdypagtyvrnppttshvpgsaegctifvklwqfdpadrtqf
    sknmeaelgapvegistsllhederetvthrklepganltseaaggievlvldgdvtvnd
    evlgrnawlrlpegealsatagargakiwmktghlrfvrtpev
    

    Sequence, based on observed residues (ATOM records):
    >3o14B (B:)
    gmeinadftkpvvidtdqlewrpspmkgverrmldriggevaratsivryapgsrfsaht
    hdggeefivldgvfqdehgdypagtyvrnppttshvpgsaegctifvklwqfdpadrtqf
    sknmeaelgapvegistsllhederetvthrklepganltseaaggievlvldgdvtvnd
    evlgrnawlrlpegealsatagargakiwmktghlrfvrtpe