PDB entry 3o13

View 3o13 on RCSB PDB site
Description: Crystal structure of a superantigen-like protein (SAV0433) from Staphylococcus aureus MU50 at 2.05 A resolution
Class: toxin
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-biology, toxin
Deposited on 2010-07-20, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superantigen-like protein
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Gene: set15, SAV0433
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o13a1, d3o13a2
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o13A (A:)
    gstlevrsqatqdlseyykgrgfeltnvtgykygnkvtfidnsqqidvtltgnekltvkd
    ddevsnvdvfvvregsdksaittsiggitktngtqhkdtvqnvnlsvskstgqhttsvts
    eyysiykeeislkeldfklrkhlidkhdlyktepkdskiritmknggyytfelnkklqph
    rmgdtidsrniekievnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o13A (A:)
    evrsqatqdlseyykgrgfeltnvtgykygnkvtfidnsqqidvtltgnekltvkdddev
    snvdvfvvregssaittsiggitktngtqhkdtvqnvnlsvskstsvtseyysiykeeis
    lkeldfklrkhlidkhdlyktepkdskiritmknggyytfelnkklqphrmgdtidsrni
    ekievnl