PDB entry 3o11

View 3o11 on RCSB PDB site
Description: Anti-beta-amyloid antibody c706 fab in space group c2
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2010-07-20, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C706 LIGHT CHAIN variable region, Ig kappa chain C region chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 3O11 (0-105)
    • Uniprot P01834 (106-211)
    Domains in SCOPe 2.07: d3o11a1, d3o11a2
  • Chain 'B':
    Compound: C706 HEAVY CHAIN variable region, Ig gamma-1 chain C region chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3O11 (0-118)
    • Uniprot P01857 (119-221)
      • expression tag (222-226)
  • Chain 'H':
    Compound: C706 HEAVY CHAIN variable region, Ig gamma-1 chain C region chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3O11 (0-118)
    • Uniprot P01857 (119-221)
      • expression tag (222-227)
  • Chain 'L':
    Compound: C706 LIGHT CHAIN variable region, Ig kappa chain C region chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 3O11 (0-105)
    • Uniprot P01834 (106-211)
    Domains in SCOPe 2.07: d3o11l1, d3o11l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o11A (A:)
    eivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydssrlasgvpsr
    fsgggsgtsysltisnmeaedaatyfcqnwrssptfgagtklelkrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o11L (L:)
    eivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydssrlasgvpsr
    fsgggsgtsysltisnmeaedaatyfcqnwrssptfgagtklelkrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrgec