PDB entry 3o0z

View 3o0z on RCSB PDB site
Description: Crystal structure of a coiled-coil domain from human ROCK I
Deposited on 2010-07-20, released 2011-03-23
The last revision was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.242
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROCK1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Rho-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROCK1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Rho-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROCK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13464 (2-End)
      • expression tag (1)
  • Chain 'D':
    Compound: Rho-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ROCK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13464 (2-End)
      • expression tag (1)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0zA (A:)
    gslaneklsqlqkqleeandllrtesdtavrlrkshtemsksisqleslnrelqernril
    ensksqtdkdyyqlqaileaerrdrghdsemigdlqaritslqeevkhlkhnlekveger
    keaqdmlnhsekeknnleidlnyklkslqqrleqevnehkvtkarltd
    

    Sequence, based on observed residues (ATOM records):
    >3o0zA (A:)
    qlqkqleeandllrtesdtavrlrkshtemsksisqleslnrelqernrilensksqtdk
    dyyqlqaileaerrdrghdsemigdlqaritslqeevkhlkhnlekvegerkeaqdmlnh
    sekeknnleidlnyklkslqqrleqevnehkv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o0zB (B:)
    gslaneklsqlqkqleeandllrtesdtavrlrkshtemsksisqleslnrelqernril
    ensksqtdkdyyqlqaileaerrdrghdsemigdlqaritslqeevkhlkhnlekveger
    keaqdmlnhsekeknnleidlnyklkslqqrleqevnehkvtkarltd
    

    Sequence, based on observed residues (ATOM records):
    >3o0zB (B:)
    sqlqkqleeandllrtesdtavrlrkshtemsksisqleslnrelqernrilensksqtd
    kdyyqlqaileaerrdrghdsemigdlqaritslqeevkhlkhnlekvegerkeaqdmln
    hsekeknnleidlnyklkslqqrleqevnehk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3o0zC (C:)
    gslaneklsqlqkqleeandllrtesdtavrlrkshtemsksisqleslnrelqernril
    ensksqtdkdyyqlqaileaerrdrghdsemigdlqaritslqeevkhlkhnlekveger
    keaqdmlnhsekeknnleidlnyklkslqqrleqevnehkvtkarltd
    

    Sequence, based on observed residues (ATOM records):
    >3o0zC (C:)
    slaneklsqlqkqleeandllrtesdtavrlrkshtemsksisqleslnrelqernrile
    nsksqtdkdyyqlqaileaerrdrghdsemigdlqaritslqeevkhlkhnlekvegerk
    eaqdmlnhsekeknnleidlnyklkslqqrleqevnehk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3o0zD (D:)
    gslaneklsqlqkqleeandllrtesdtavrlrkshtemsksisqleslnrelqernril
    ensksqtdkdyyqlqaileaerrdrghdsemigdlqaritslqeevkhlkhnlekveger
    keaqdmlnhsekeknnleidlnyklkslqqrleqevnehkvtkarltd
    

    Sequence, based on observed residues (ATOM records):
    >3o0zD (D:)
    slaneklsqlqkqleeandllrtesdtavrlrkshtemsksisqleslnrelqernrile
    nsksqtdkdyyqlqaileaerrdrghdsemigdlqaritslqeevkhlkhnlekvegerk
    eaqdmlnhsekeknnleidlnyklkslqqrleqevnehkv