PDB entry 3o0y

View 3o0y on RCSB PDB site
Description: The crystal structure of the putative lipoprotein from Colwellia psychrerythraea
Deposited on 2010-07-20, released 2010-09-22
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.148
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_3202
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Lipoprotein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_3202
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Lipoprotein
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_3202
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, TRS, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0yA (A:)
    nenntvvaetktstasetsepkqvisskqqlaslylqakqslfkqralsatmyglsqkdi
    gqvissdmefyspenekqlraellsisntiagiklddadittknnqqvmagltryfagep
    nfnigyidtwmglspfivnqingplidiprvmqndqpittekealdyivrlgqfdklaat
    iiekqtadaaqnwlpskvtlqgaikylkgftsgsaeqhpfvnvfrekiekvdsltteqkq
    slitqviakvsqvvypayqsvekaseqllsearsesgiwaqpkgsvyyqdaikqlgdsel
    sptqihqigldevarisgvmneillaqgytkgtvgermvalneeprflyedsiagreell
    sdingyitevtakmapvfrttpsyqvevksfpvevqdgapggqytspavdgskpgiywin
    lrdmkanpkfglktltyheanpghhwqialnldqaelpflrriapynaytegwalyseqv
    ayelgmyendpfgdlgrlqaelfravrlvvdtglhdkrwtreqaisymseqtgtaesdvv
    aeierymawpgqalgyklgmlkilslreqakarlgdkfdlaefhdvvllngavpmavlsr
    nvnhwldnk
    

    Sequence, based on observed residues (ATOM records):
    >3o0yA (A:)
    visskqqlaslylqakqslfkqralsatmyglsqkdigqvissdmefyspenekqlrael
    lsisntiagikldadittknnqqvmagltryfagepnfnigyidtwmglspfivnqingp
    lidiprvmqndqpittekealdyivrlgqfdklaatiiekqtadaaqnwlpskvtlqgai
    kylkgftsgsaeqhpfvnvfrekiekvdsltteqkqslitqviakvsqvvypayqsveka
    seqllsearsesgiwaqpkgsvyyqdaikqlgdselsptqihqigldevarisgvmneil
    laqgytkgtvgermvalneeprflyedsiagreellsdingyitevtakmapvfrttpsy
    qvevksfpvevqdgapggqytspavdgskpgiywinlrdmkanpkfglktltyheanpgh
    hwqialnldqaelpflrriapynaytegwalyseqvayelgmyendpfgdlgrlqaelfr
    avrlvvdtglhdkrwtreqaisymseqtgtaesdvvaeierymawpgqalgyklgmlkil
    slreqakarlgdkfdlaefhdvvllngavpmavlsrnvnhwldnk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o0yB (B:)
    nenntvvaetktstasetsepkqvisskqqlaslylqakqslfkqralsatmyglsqkdi
    gqvissdmefyspenekqlraellsisntiagiklddadittknnqqvmagltryfagep
    nfnigyidtwmglspfivnqingplidiprvmqndqpittekealdyivrlgqfdklaat
    iiekqtadaaqnwlpskvtlqgaikylkgftsgsaeqhpfvnvfrekiekvdsltteqkq
    slitqviakvsqvvypayqsvekaseqllsearsesgiwaqpkgsvyyqdaikqlgdsel
    sptqihqigldevarisgvmneillaqgytkgtvgermvalneeprflyedsiagreell
    sdingyitevtakmapvfrttpsyqvevksfpvevqdgapggqytspavdgskpgiywin
    lrdmkanpkfglktltyheanpghhwqialnldqaelpflrriapynaytegwalyseqv
    ayelgmyendpfgdlgrlqaelfravrlvvdtglhdkrwtreqaisymseqtgtaesdvv
    aeierymawpgqalgyklgmlkilslreqakarlgdkfdlaefhdvvllngavpmavlsr
    nvnhwldnk
    

    Sequence, based on observed residues (ATOM records):
    >3o0yB (B:)
    isskqqlaslylqakqslfkqralsatmyglsqkdigqvissdmefyspenekqlraell
    sisntiagiklddadittknnqqvmagltryfagepnfnigyidtwmglspfivnqingp
    lidiprvmqndqpittekealdyivrlgqfdklaatiiekqtadaaqnwlpskvtlqgai
    kylkgftsgsaeqhpfvnvfrekiekvdsltteqkqslitqviakvsqvvypayqsveka
    seqllsearsesgiwaqpkgsvyyqdaikqlgdselsptqihqigldevarisgvmneil
    laqgytkgtvgermvalneeprflyedsiagreellsdingyitevtakmapvfrttpsy
    qvevksfpvevqdgapggqytspavdgskpgiywinlrdmkanpkfglktltyheanpgh
    hwqialnldqaelpflrriapynaytegwalyseqvayelgmyendpfgdlgrlqaelfr
    avrlvvdtglhdkrwtreqaisymseqtgtaesdvvaeierymawpgqalgyklgmlkil
    slreqakarlgdkfdlaefhdvvllngavpmavlsrnvnhwldnk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3o0yC (C:)
    nenntvvaetktstasetsepkqvisskqqlaslylqakqslfkqralsatmyglsqkdi
    gqvissdmefyspenekqlraellsisntiagiklddadittknnqqvmagltryfagep
    nfnigyidtwmglspfivnqingplidiprvmqndqpittekealdyivrlgqfdklaat
    iiekqtadaaqnwlpskvtlqgaikylkgftsgsaeqhpfvnvfrekiekvdsltteqkq
    slitqviakvsqvvypayqsvekaseqllsearsesgiwaqpkgsvyyqdaikqlgdsel
    sptqihqigldevarisgvmneillaqgytkgtvgermvalneeprflyedsiagreell
    sdingyitevtakmapvfrttpsyqvevksfpvevqdgapggqytspavdgskpgiywin
    lrdmkanpkfglktltyheanpghhwqialnldqaelpflrriapynaytegwalyseqv
    ayelgmyendpfgdlgrlqaelfravrlvvdtglhdkrwtreqaisymseqtgtaesdvv
    aeierymawpgqalgyklgmlkilslreqakarlgdkfdlaefhdvvllngavpmavlsr
    nvnhwldnk
    

    Sequence, based on observed residues (ATOM records):
    >3o0yC (C:)
    isskqqlaslylqakqslfkqralsatmyglsqkdigqvissdmefyspenekqlraell
    sisntiagiklddadittknnqqvmagltryfagepnfnigyidtwmglspfivnqingp
    lidiprvmqndqpittekealdyivrlgqfdklaatiiekqtadaaqnwlpskvtlqgai
    kylkgftsgsaeqhpfvnvfrekiekvdsltteqkqslitqviakvsqvvypayqsveka
    seqllsearsesgiwaqpkgsvyyqdaikqlgdselsptqihqigldevarisgvmneil
    laqgytkgtvgermvalneeprflyedsiagreellsdingyitevtakmapvfrttpsy
    qvevksfpvevqdgapggqytspavdgskpgiywinlrdmkanpkfglktltyheanpgh
    hwqialnldqaelpflrriapynaytegwalyseqvayelgmyendpfgdlgrlqaelfr
    avrlvvdtglhdkrwtreqaisymseqtgtaesdvvaeierymawpgqalgyklgmlkil
    slreqakarlgdkfdlaefhdvvllngavpmavlsrnvnhwldnk