PDB entry 3o0x

View 3o0x on RCSB PDB site
Description: structural basis of carbohydrate recognition by calreticulin
Deposited on 2010-07-20, released 2010-09-29
The last revision was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calreticulin
    Species: Mus musculus [TaxId:10090]
    Gene: Calr
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3TVD2 (3-End)
      • engineered mutation (148)
    • Uniprot Q3TVD2 (197-End)
  • Chain 'B':
    Compound: calreticulin
    Species: Mus musculus [TaxId:10090]
    Gene: Calr
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3TVD2 (3-End)
      • engineered mutation (148)
    • Uniprot Q3TVD2 (197-End)
  • Heterogens: MAN, GLC, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0xA (A:)
    gsmdpaiyfkeqfldgdawtnrwveskhksdfgkfvlssgkfygdlekdkglqtsqdarf
    yalsakfepfsnkgqtlvvqftvkheqnidcgggyvklfpsgldqkdmhgdseynimfgp
    dicgpgtkkvhvifnykgknvlinkdirskddefthlytlivrpdntyevkidnsqvesg
    sleddwdflppkgsgsgpdaniyaydsfavlgldlwqvksgtifdnflitndeayaeefg
    netwgvtkaaekqmkdkqdeeqrlklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3o0xA (A:)
    dpaiyfkeqfldgdawtnrwveskhksdfgkfvlssgkfygdlekdkglqtsqdarfyal
    sakfepfsnkgqtlvvqftvkheqnidcgggyvklfpsgldqkdmhgdseynimfgpdic
    gpgtkkvhvifnykgknvlinkdirskddefthlytlivrpdntyevkidnsqvesgsle
    ddwdfpdaniyaydsfavlgldlwqvksgtifdnflitndeayaeefgnetwgvtkaaek
    qmkdkqdeeq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o0xB (B:)
    gsmdpaiyfkeqfldgdawtnrwveskhksdfgkfvlssgkfygdlekdkglqtsqdarf
    yalsakfepfsnkgqtlvvqftvkheqnidcgggyvklfpsgldqkdmhgdseynimfgp
    dicgpgtkkvhvifnykgknvlinkdirskddefthlytlivrpdntyevkidnsqvesg
    sleddwdflppkgsgsgpdaniyaydsfavlgldlwqvksgtifdnflitndeayaeefg
    netwgvtkaaekqmkdkqdeeqrlklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3o0xB (B:)
    dpaiyfkeqfldgdawtnrwveskhksdfgkfvlssgkfygdlekdkglqtsqdarfyal
    sakfepfsnkgqtlvvqftvkheqnidcgggyvklfpsgldqkdmhgdseynimfgpdic
    gpgtkkvhvifnykgknvlinkdirskddefthlytlivrpdntyevkidnsqvesgsle
    ddwdfpdaniyaydsfavlgldlwqvksgtifdnflitndeayaeefgnetwgvtkaaek
    qmkdkqdee