PDB entry 3o0v

View 3o0v on RCSB PDB site
Description: crystal structure of the calreticulin lectin domain
Deposited on 2010-07-20, released 2010-09-29
The last revision was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calreticulin
    Species: Mus musculus [TaxId:10090]
    Gene: Calr
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3TVD2 (3-End)
      • expression tag (0-2)
      • engineered mutation (148)
    • Uniprot Q3TVD2 (197-End)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0vA (A:)
    gsmdpaiyfkeqfldgdawtnrwveskhksdfgkfvlssgkfygdlekdkglqtsqdarf
    yalsakfepfsnkgqtlvvqftvkheqnidcgggyvklfpsgldqkdmhgdseynimfgp
    dicgpgtkkvhvifnykgknvlinkdirskddefthlytlivrpdntyevkidnsqvesg
    sleddwdflppkgsgsgpdaniyaydsfavlgldlwqvksgtifdnflitndeayaeefg
    netwgvtkaaekqmkdkqdeeqrlklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3o0vA (A:)
    gsmdpaiyfkeqfldgdawtnrwveskhksdfgkfvlssgkfygdlekdkglqtsqdarf
    yalsakfepfsnkgqtlvvqftvkheqnidcgggyvklfpsgldqkdmhgdseynimfgp
    dicgpgtkkvhvifnykgknvlinkdirskddefthlytlivrpdntyevkidnsqvesg
    sleddwdfpdaniyaydsfavlgldlwqvksgtifdnflitndeayaeefgnetwgvtka
    aekqmkdkqde