PDB entry 3o0u

View 3o0u on RCSB PDB site
Description: Cathepsin K covalently bound to a cyano-pyrimidine inhibitor with improved selectivity over hERG
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase, covalent 2-cyano-pyrimidine inhibitor, reversible covalent bond between Cys25 and ligand, bone, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-07-20, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o0ua_
  • Heterogens: O47, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3o0uA (A:)
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm