PDB entry 3o0t

View 3o0t on RCSB PDB site
Description: crystal structure of human phosphoglycerate mutase family member 5 (pgam5) in complex with phosphate
Deposited on 2010-07-20, released 2010-10-06
The last revision was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase PGAM5, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96HS1 (2-201)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Serine/threonine-protein phosphatase PGAM5, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96HS1 (2-201)
      • expression tag (0-1)
  • Heterogens: PO4, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0tA (A:)
    smdhykakatrhiflirhsqyhvdgslekdrtltplgreqaeltglrlaslglkfnkivh
    ssmtraiettdiisrhlpgvckvstdllregapiepdppvshwkpeavqyyedgarieaa
    frnyihradarqeedsyeifichanviryivcralqfppegwlrlslnngsithlvirpn
    grvalrtlgdtgfmppdkitrs
    

    Sequence, based on observed residues (ATOM records):
    >3o0tA (A:)
    smdhykakatrhiflirhsqyhvdgslekdrtltplgreqaeltglrlaslglkfnkivh
    ssmtraiettdiisrhlpgvckvstdllregapiepeavqyyedgarieaafrnyihrad
    arqeedsyeifichanviryivcralqfppegwlrlslnngsithlvirpngrvalrtlg
    dtgfmppdkitrs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o0tB (B:)
    smdhykakatrhiflirhsqyhvdgslekdrtltplgreqaeltglrlaslglkfnkivh
    ssmtraiettdiisrhlpgvckvstdllregapiepdppvshwkpeavqyyedgarieaa
    frnyihradarqeedsyeifichanviryivcralqfppegwlrlslnngsithlvirpn
    grvalrtlgdtgfmppdkitrs
    

    Sequence, based on observed residues (ATOM records):
    >3o0tB (B:)
    smdhykakatrhiflirhsqyhvdgslekdrtltplgreqaeltglrlaslglkfnkivh
    ssmtraiettdiisrhlpgvckvstdllregapeavqyyedgarieaafrnyihradarq
    eedsyeifichanviryivcralqfppegwlrlslnngsithlvirpngrvalrtlgdtg
    fmppdkitrs