PDB entry 3o0q

View 3o0q on RCSB PDB site
Description: thermotoga maritima ribonucleotide reductase, nrdj, in complex with dttp, gdp and adenosine
Deposited on 2010-07-19, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nrdJ, TM_0118
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33839 (0-End)
      • see remark 999 (204)
  • Chain 'B':
    Compound: ribonucleoside-diphosphate reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nrdJ, TM_0118
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33839 (0-End)
      • see remark 999 (204)
  • Heterogens: TTP, MG, GDP, ADN, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0qA (A:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsrrrgalmgilninhpdieefidakkentgeavlnf
    fnlsvgfpmdkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaf
    lgemnkyyplyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqi
    avrfldnvidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlm
    afialhahrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefr
    rnvalltiaptgsisniadtssglepnfllaytrfvtkedgtkepllyvnqvlreklnpe
    ilkriekeliekgslkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktin
    mpqsatvddvlnvylealrtnvrgitvyrdgslqtqvltkalkt
    

    Sequence, based on observed residues (ATOM records):
    >3o0qA (A:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsrrrgalmgilninhpdieefidakvlnffnlsvgf
    pmdkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaflgemnky
    yplyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqiavrfldn
    vidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlmafialha
    hrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefrrnvallt
    iaptgsisniadtssglepnfllaytrfpllyvnqvlreklnpeilkriekeliekgslk
    dipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktinmpqsatvddvlnvyle
    alrtnvrgitvyrdgsl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o0qB (B:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsrrrgalmgilninhpdieefidakkentgeavlnf
    fnlsvgfpmdkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaf
    lgemnkyyplyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqi
    avrfldnvidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlm
    afialhahrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefr
    rnvalltiaptgsisniadtssglepnfllaytrfvtkedgtkepllyvnqvlreklnpe
    ilkriekeliekgslkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktin
    mpqsatvddvlnvylealrtnvrgitvyrdgslqtqvltkalkt
    

    Sequence, based on observed residues (ATOM records):
    >3o0qB (B:)
    mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnp
    sykknekldrikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyee
    iyrsrnhlhmlsacfvvpvgdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagt
    hgkasgpvsfmhvfnsaisvvkqgsrrrgalmgilninhpdieefidakkvlnffnlsvg
    fpmdkkeilklyeedgelelshprstirkkvkirelfrkiatnawksgdpglaflgemnk
    yyplyphrkinstnpcgeiglsdyeacnlgsidvakfynngfvdlealqelvqiavrfld
    nvidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardfaanlmafialh
    ahrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefrrnvall
    tiaptgsisniadtssglepnfllaytrfllyvnqvlreklnpeilkriekeliekgslk
    dipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktinmpqsatvddvlnvyle
    alrtnvrgitvyrdgsl