PDB entry 3o0p

View 3o0p on RCSB PDB site
Description: Pilus-related Sortase C of Group B Streptococcus
Deposited on 2010-07-19, released 2011-03-09
The last revision was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.156
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sortase family protein
    Species: Streptococcus agalactiae [TaxId:342614]
    Gene: Pilus Island 2a (PI-2a), SAL_1484
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0pA (A:)
    gsftesnnqtqdferaakklsqkeinrrmalaqayndslnnvhledpyekkriqkgiaey
    armlevsekigiisvpkigqklpifagssqevlskgaghlegtslpiggnsthtvitahs
    gipdkelfsnlkklkkgdkfyiqniketiayqvdqikvvtpdnfsdllvvpghdyatllt
    ctpimvnthrllvrghripykgpideklikdghlnt
    

    Sequence, based on observed residues (ATOM records):
    >3o0pA (A:)
    qtqdferaakklsqkeinrrmalaqayndslnnvhledpyekkrigiaeyarmlevseki
    giisvpkigqklpifagssqevlskgaghlegtslpiggnsthtvitahsgipdkelfsn
    lkklkkgdkfyiqniketiayqvdqikvvtpdnfsdllvvpghdyatlltctpimvnthr
    llvrghripykghl