PDB entry 3o0m

View 3o0m on RCSB PDB site
Description: Crystal structure of a ZN-bound histidine triad family protein from Mycobacterium smegmatis
Class: hydrolase
Keywords: SSGCID, NIH, NIAID, SBRI, UW, EMERALD BIOSTRUCTURES, HYDROLASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2010-07-19, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIT family protein
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: 4533102, MSMEG_5028
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0R291 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3o0ma1, d3o0ma2
  • Chain 'B':
    Compound: HIT family protein
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: 4533102, MSMEG_5028
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o0mb_
  • Heterogens: ZN, ACT, AMP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o0mA (A:)
    gpgsmscvfcaivsgdapairiyedenflgildirpftrghtlvipkthtvdltdtppet
    vagmaavgqriaraaresglhadgnniaindgkaafqtvfhihlhvvprrngdklsfakg
    mvmrrdpdreesgrllraalaqldsaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0mA (A:)
    gsmscvfcaivsgdapairiyedenflgildirpftrghtlvipkthtvdltdtppetva
    gmaavgqriaraaresglhadgnniaindgkaafqtvfhihlhvvprrngdklsfrrdpd
    reesgrllraalaqldsae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o0mB (B:)
    gpgsmscvfcaivsgdapairiyedenflgildirpftrghtlvipkthtvdltdtppet
    vagmaavgqriaraaresglhadgnniaindgkaafqtvfhihlhvvprrngdklsfakg
    mvmrrdpdreesgrllraalaqldsaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0mB (B:)
    scvfcaivsgdapairiyedenflgildirpftrghtlvipkthtvdltdtppetvagma
    avgqriaraaresglhadgnniaindgkaafqtvfhihlhvvprrngdklsfrrdpdree
    sgrllraalaqldsa