PDB entry 3o0l

View 3o0l on RCSB PDB site
Description: Crystal structure of a Pfam DUF1425 family member (Shew_1734) from Shewanella sp. pv-4 at 1.81 a resolution
Deposited on 2010-07-19, released 2010-08-04
The last revision was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.205
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Shewanella loihica [TaxId:323850]
    Gene: Shew_1734
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Shewanella loihica [TaxId:323850]
    Gene: Shew_1734
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0lA (A:)
    gphtggimisstgevrvdngsfhsdvdvsavttqaeagflrargtiiskspkdqrlqykf
    twydingatvedegvswkslklhgkqqmqvtalspnatavrcelyvreaisn
    

    Sequence, based on observed residues (ATOM records):
    >3o0lA (A:)
    htggimisstgevrvdngsfhsdvdvsavttqaeagflrargtiiskspkdqrlqykftw
    ydingatvedegvswkslklhgkqqmqvtalspnatavrcelyvreais
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o0lB (B:)
    gphtggimisstgevrvdngsfhsdvdvsavttqaeagflrargtiiskspkdqrlqykf
    twydingatvedegvswkslklhgkqqmqvtalspnatavrcelyvreaisn
    

    Sequence, based on observed residues (ATOM records):
    >3o0lB (B:)
    ggimisstgevrvdngsfhsdvdvsavttqaeagflrargtiiskspkdqrlqykftwyd
    ingatvedegvswkslklhgkqqmqvtalspnatavrcelyvreaisn