PDB entry 3o0k

View 3o0k on RCSB PDB site
Description: Crystal structure of ALDO/KETO reductase from brucella melitensis
Class: oxidoreductase
Keywords: SSGCID, ALS COLLABORATIVE CRYSTALLOGRAPHY, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2010-07-19, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo/keto reductase
    Species: Brucella melitensis biovar [TaxId:359391]
    Gene: 3827820, BAB2_0177
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YII2 (22-282)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d3o0ka1, d3o0ka2
  • Chain 'B':
    Compound: Aldo/keto reductase
    Species: Brucella melitensis biovar [TaxId:359391]
    Gene: 3827820, BAB2_0177
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o0kb_
  • Chain 'C':
    Compound: Aldo/keto reductase
    Species: Brucella melitensis biovar [TaxId:359391]
    Gene: 3827820, BAB2_0177
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o0kc_
  • Chain 'D':
    Compound: Aldo/keto reductase
    Species: Brucella melitensis biovar [TaxId:359391]
    Gene: 3827820, BAB2_0177
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o0kd_
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o0kA (A:)
    mahhhhhhmgtleaqtqgpgsmimtvptvklndgnhipqlgygvwqisndeavsavseal
    kagyrhidtatiygneegvgkaingsgiaradiflttklwnsdqgyestlkafdtslkkl
    gtdyvdlylihwpmpskdlfmetwrafiklkeegrvksigvsnfrtadlerlikesgvtp
    vlnqielhpqfqqdelrlfhgkhdiateawsplgqgklledptlksiaekhaksvaqiil
    rwhietgnivipksitparikenfdifdftlngtdhdaitkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0kA (A:)
    smimtvptvklndgnhipqlgygvwqisndeavsavsealkagyrhidtatiygneegvg
    kaingsgiaradiflttklwnsdqgyestlkafdtslkklgtdyvdlylihwpmpskdlf
    metwrafiklkeegrvksigvsnfrtadlerlikesgvtpvlnqielhpqfqqdelrlfh
    gkhdiateawsplgqglledptlksiaekhaksvaqiilrwhietgnivipksitparik
    enfdifdftlngtdhdaitkld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o0kB (B:)
    mahhhhhhmgtleaqtqgpgsmimtvptvklndgnhipqlgygvwqisndeavsavseal
    kagyrhidtatiygneegvgkaingsgiaradiflttklwnsdqgyestlkafdtslkkl
    gtdyvdlylihwpmpskdlfmetwrafiklkeegrvksigvsnfrtadlerlikesgvtp
    vlnqielhpqfqqdelrlfhgkhdiateawsplgqgklledptlksiaekhaksvaqiil
    rwhietgnivipksitparikenfdifdftlngtdhdaitkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0kB (B:)
    tvptvklndgnhipqlgygvwqisndeavsavsealkagyrhidtatiygneegvgkain
    gsgiaradiflttklwnsdqgyestlkafdtslkklgtdyvdlylihwpmpskdlfmetw
    rafiklkeegrvksigvsnfrtadlerlikesgvtpvlnqielhpqfqqdelrlfhgkhd
    iateawsplglledptlksiaekhaksvaqiilrwhietgnivipksitparikenfdif
    dftlngtdhdaitkld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o0kC (C:)
    mahhhhhhmgtleaqtqgpgsmimtvptvklndgnhipqlgygvwqisndeavsavseal
    kagyrhidtatiygneegvgkaingsgiaradiflttklwnsdqgyestlkafdtslkkl
    gtdyvdlylihwpmpskdlfmetwrafiklkeegrvksigvsnfrtadlerlikesgvtp
    vlnqielhpqfqqdelrlfhgkhdiateawsplgqgklledptlksiaekhaksvaqiil
    rwhietgnivipksitparikenfdifdftlngtdhdaitkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0kC (C:)
    tvptvklndgnhipqlgygvwqisndeavsavsealkagyrhidtatiygneegvgkain
    gsgiaradiflttklwnsdqgyestlkafdtslkklgtdyvdlylihwpmpskdlfmetw
    rafiklkeegrvksigvsnfrtadlerlikesgvtpvlnqielhpqfqqdelrlfhgkhd
    iateawsplglledptlksiaekhaksvaqiilrwhietgnivipksitparikenfdif
    dftlngtdhdaitkld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3o0kD (D:)
    mahhhhhhmgtleaqtqgpgsmimtvptvklndgnhipqlgygvwqisndeavsavseal
    kagyrhidtatiygneegvgkaingsgiaradiflttklwnsdqgyestlkafdtslkkl
    gtdyvdlylihwpmpskdlfmetwrafiklkeegrvksigvsnfrtadlerlikesgvtp
    vlnqielhpqfqqdelrlfhgkhdiateawsplgqgklledptlksiaekhaksvaqiil
    rwhietgnivipksitparikenfdifdftlngtdhdaitkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0kD (D:)
    tvptvklndgnhipqlgygvwqisndeavsavsealkagyrhidtatiygneegvgkain
    gsgiaradiflttklwnsdqgyestlkafdtslkklgtdyvdlylihwpmpskdlfmetw
    rafiklkeegrvksigvsnfrtadlerlikesgvtpvlnqielhpqfqqdelrlfhgkhd
    iateawsplgklledptlksiaekhaksvaqiilrwhietgnivipksitparikenfdi
    fdftlngtdhdaitkld