PDB entry 3o0i

View 3o0i on RCSB PDB site
Description: Structure of the human Hsp90-alpha N-domain bound to the hsp90 inhibitor PU-H54
Class: chaperone/Inhibitor
Keywords: HSP90 Heat-Shock Proteins, chaperone-Inhibitor complex
Deposited on 2010-07-19, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.209
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HSP90AA1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o0ia_
  • Heterogens: P54, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o0iA (A:)
    mgsshhhhhhssglvprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysn
    keiflrelisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtk
    adlinnlgtiaksgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqy
    awessaggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitl
    fvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o0iA (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfve