PDB entry 3o0h

View 3o0h on RCSB PDB site
Description: Crystal structure of glutathione reductase from Bartonella henselae
Deposited on 2010-07-19, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione reductase
    Species: Bartonella henselae [TaxId:283166]
    Gene: gor, BH06430
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: glutathione reductase
    Species: Bartonella henselae [TaxId:283166]
    Gene: gor, BH06430
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0hA (A:)
    mahhhhhhmgtleaqtqgpgsmgsfdfdlfvigsgsggvraarlagalgkrvaiaeeyri
    ggtcvirgcvpkklyfyasqyaqefsksigfgwkyadpifnweklvaaknkeisrlegly
    reglqnsnvhiyesravfvdehtlelsvtgerisaekiliatgakivsnsaikgsdlclt
    sneifdleklpksivivgggyigvefanifhglgvkttllhrgdlilrnfdydlrqllnd
    amvakgisiiyeatvsqvqstencynvvltngqticadrvmlatgrvpnttglgleragv
    kvnefgavvvdekmttnvshiwavgdvtghiqltpvaihdamcfvknafentsttpdydl
    ittavfsqpeigtvglseedalhrykrveiyrtvfrpmrnvlsgspekmfmklvvdgesr
    ivvgahvlgenageiaqligislkgkltkdifdktmavhptmseelvtmykpsyvyenge
    kldn
    

    Sequence, based on observed residues (ATOM records):
    >3o0hA (A:)
    sfdfdlfvigsgsggvraarlagalgkrvaiaeeyriggtcvirgcvpkklyfyasqyaq
    efsksigfgwkyadpifnweklvaaknkeisrleglyreglqnsnvhiyesravfvdeht
    lelsvtgerisaekiliatgakivsnikgsdlcltsneifdleklpksivivgggyigve
    fanifhglgvkttllhrgdlilrnfdydlrqllndamvakgisiiyeatvsqvqstency
    nvvltngqticadrvmlatgrvpnttglgleragvkvnefgavvvdekmttnvshiwavg
    dvtghiqltpvaihdamcfvknafettpdydlittavfsqpeigtvglseedalhrykrv
    eiyrtvfrpmrnvlsgspekmfmklvvdgesrivvgahvlgenageiaqligislkgklt
    kdifdktmavhptmseelvtmykpsyvyengekld
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o0hB (B:)
    mahhhhhhmgtleaqtqgpgsmgsfdfdlfvigsgsggvraarlagalgkrvaiaeeyri
    ggtcvirgcvpkklyfyasqyaqefsksigfgwkyadpifnweklvaaknkeisrlegly
    reglqnsnvhiyesravfvdehtlelsvtgerisaekiliatgakivsnsaikgsdlclt
    sneifdleklpksivivgggyigvefanifhglgvkttllhrgdlilrnfdydlrqllnd
    amvakgisiiyeatvsqvqstencynvvltngqticadrvmlatgrvpnttglgleragv
    kvnefgavvvdekmttnvshiwavgdvtghiqltpvaihdamcfvknafentsttpdydl
    ittavfsqpeigtvglseedalhrykrveiyrtvfrpmrnvlsgspekmfmklvvdgesr
    ivvgahvlgenageiaqligislkgkltkdifdktmavhptmseelvtmykpsyvyenge
    kldn
    

    Sequence, based on observed residues (ATOM records):
    >3o0hB (B:)
    sfdfdlfvigsgsggvraarlagalgkrvaiaeeyriggtcvirgcvpkklyfyasqyaq
    efsksigfgwkyadpifnweklvaaknkeisrleglyreglqnsnvhiyesravfvdeht
    lelsvtgerisaekiliatgakivsnsikgsdlcltsneifdleklpksivivgggyigv
    efanifhglgvkttllhrgdlilrnfdydlrqllndamvakgisiiyeatvsqvqstenc
    ynvvltngqticadrvmlatgrvpnttglgleragvkvnefgavvvdekmttnvshiwav
    gdvtghiqltpvaihdamcfvknafentsttpdydlittavfsqpeigtvglseedalhr
    ykrveiyrtvfrpmrnvlsgspekmfmklvvdgesrivvgahvlgenageiaqligislk
    gkltkdifdktmavhptmseelvtmykpsyvyengekld