PDB entry 3o0f

View 3o0f on RCSB PDB site
Description: Crystal structure of a putative metal-dependent phosphoesterase (BAD_1165) from bifidobacterium adolescentis atcc 15703 at 1.94 A resolution
Deposited on 2010-07-19, released 2010-08-25
The last revision was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.161
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Metal-dependent Phosphoesterase
    Species: Bifidobacterium adolescentis [TaxId:367928]
    Gene: BAD_1165
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, ZN, FE, PO4, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0fA (A:)
    gmshvsyaeppaqgwdihchtvfsdgtetprtlveqarklglhgvaiadhdttagwdeat
    easeeiglplllgteitavdedvsvhmlafqydpsnehissmfantraarlrrtkrmver
    lsqdfpitwddvlaqvkegerttigrphiadalvaagvyetrsdafadavsakskyyipt
    pspstheviaavkgaggvvvaahagdpqrnrrllsdeqldamiadgldglevwhrgnppe
    qrerlltiaarhdllvtggsdwhgkgkpnglgenltdddtvreilcrgvdligrvgssha
    a
    

    Sequence, based on observed residues (ATOM records):
    >3o0fA (A:)
    aeppaqgwdihchtvfsdgtetprtlveqarklglhgvaiadhdttagwdeateaseeig
    lplllgteitavdedvsvhmlafqydpsnehissmfantraarlrrtkrmverlsqdfpi
    twddvlaqvkegerttigrphiadalvaagvyetrsdafadavsakskyyiptpspsthe
    viaavkgaggvvvaahagdpqrnrrllsdeqldamiadgldglevwhrgnppeqrerllt
    iaarhdllvtggsdwhgkgkpnglgenltdddtvreilcrgvdligr