PDB entry 3o0e

View 3o0e on RCSB PDB site
Description: Crystal structure of OmpF in complex with colicin peptide OBS1
Deposited on 2010-07-19, released 2010-12-08
The last revision was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.21
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane porin 1a (Ia;b;F)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Outer membrane porin 1a (Ia;b;F)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Outer membrane porin 1a (Ia;b;F)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Outer membrane porin 1a (Ia;b;F)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Outer membrane porin 1a (Ia;b;F)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Outer membrane porin 1a (Ia;b;F)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BOG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3o0eA (A:)
    aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
    weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
    dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
    eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
    tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
    yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3o0eB (B:)
    aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
    weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
    dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
    eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
    tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
    yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3o0eC (C:)
    aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
    weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
    dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
    eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
    tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
    yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3o0eD (D:)
    aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
    weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
    dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
    eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
    tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
    yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3o0eE (E:)
    aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
    weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
    dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
    eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
    tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
    yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >3o0eF (F:)
    aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
    weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
    dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
    eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
    tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
    yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3o0eL (L:)
    sggdgrghntgahstsg
    

    Sequence, based on observed residues (ATOM records):
    >3o0eL (L:)
    sggdgrghntgahst
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3o0eM (M:)
    sggdgrghntgahstsg
    

    Sequence, based on observed residues (ATOM records):
    >3o0eM (M:)
    sggdgrghntg
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >3o0eN (N:)
    sggdgrghntgahstsg
    

    Sequence, based on observed residues (ATOM records):
    >3o0eN (N:)
    sggdgrghntg
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3o0eO (O:)
    sggdgrghntgahstsg
    

    Sequence, based on observed residues (ATOM records):
    >3o0eO (O:)
    sggdgrghntg
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3o0eP (P:)
    sggdgrghntgahstsg
    

    Sequence, based on observed residues (ATOM records):
    >3o0eP (P:)
    sggdgrghntg
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >3o0eQ (Q:)
    sggdgrghntgahstsg
    

    Sequence, based on observed residues (ATOM records):
    >3o0eQ (Q:)
    sggdgrghntg