PDB entry 3o0a

View 3o0a on RCSB PDB site
Description: Crystal structure of the wild type CP1 hydrolitic domain from Aquifex Aeolicus leucyl-trna
Deposited on 2010-07-19, released 2010-11-17
The last revision was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucyl-tRNA synthetase subunit alpha
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: leuS, aq_351
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Leucyl-tRNA synthetase subunit alpha
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: leuS, aq_351
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o0aA (A:)
    grsegalirfyveieepekflncvpeelketllkekriyidvfttrpdtvfgatfvvlap
    ehplvpvlacigerlgnacysdvenfvekmkkmstrertmeedkegvflgvyatnpange
    kipvwsanyvlyeygtgaimcvpahdqrdwefakkydlpikvvvkpegawdfekgayegk
    gtlvnsdgfdgldsetakrkitewlqdrglgekkvsyrl
    

    Sequence, based on observed residues (ATOM records):
    >3o0aA (A:)
    egalirfyveieepekflncvpeelketllkekriyidvfttrpdtvfgatfvvlapehp
    lvpvlacigerlgnacysdvenfvekmkkmstrertmeedkegvflgvyatnpangekip
    vwsanyvlyeygtgaimcvpahdqrdwefakkydlpikvvvkpegawdfekgayegkgtl
    vnsdgfdgldsetakrkitewlqdrglgekk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o0aB (B:)
    grsegalirfyveieepekflncvpeelketllkekriyidvfttrpdtvfgatfvvlap
    ehplvpvlacigerlgnacysdvenfvekmkkmstrertmeedkegvflgvyatnpange
    kipvwsanyvlyeygtgaimcvpahdqrdwefakkydlpikvvvkpegawdfekgayegk
    gtlvnsdgfdgldsetakrkitewlqdrglgekkvsyrl
    

    Sequence, based on observed residues (ATOM records):
    >3o0aB (B:)
    egalirfyveieepekflncvpeelketllkekriyidvfttrpdtvfgatfvvlapehp
    lvpvlacigerlgnacysdvenfvekmkkmstrertmeedkegvflgvyatnpangekip
    vwsanyvlyeygtgaimcvpahdqrdwefakkydlpikvvvkpegawdfekgayegkgtl
    vnsdgfdgldsetakrkitewlqdrglgekkvsy