PDB entry 3o08

View 3o08 on RCSB PDB site
Description: Crystal structure of dimeric KlHxk1 in crystal form I
Class: transferase
Keywords: RNaseH-like fold, Hexokinase, Glycolysis, Glucose repression, ATP binding, Mig1 binding, Transferase
Deposited on 2010-07-19, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexokinase
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: KLLA0D11352g, RAG5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o08a1, d3o08a2
  • Chain 'B':
    Compound: hexokinase
    Species: Kluyveromyces lactis [TaxId:28985]
    Gene: KLLA0D11352g, RAG5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o08b1, d3o08b2
  • Heterogens: SO4, NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o08A (A:)
    mvrlgpkkpparkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkg
    gnipmipgwvveyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrt
    gtseqlwsfiakclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdie
    gveghdvvpmlqeqieklnipinvvalindttgtlvaslytdpqtkmgiiigtgvngayy
    dvvsgieklegllpedigpdspmainceygsfdnehlvlprtkydviideesprpgqqaf
    ekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdtsypskieddpfenledt
    ddlfktnlniettvverklirklaelvgtraarltvcgvsaicdkrgyktahiaadgsvf
    nrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvgaaiiacltqkrlaagksv
    gikge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o08A (A:)
    smadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkggnipmipgwvveyp
    tgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtgtseqlwsfiakcl
    kefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdiegveghdvvpmlqeq
    ieklnipinvvalindttgtlvaslytdpqtkmgiiigtgvngayydvvsgieklegllp
    edigpdspmainceygsfdnehlvlprtkydviideesprpgqqafekmtsgyylgeimr
    lvlldlydsgfifkdqdisklkeayvmdtsypskieddpfenledtddlfktnlniettv
    verklirklaelvgtraarltvcgvsaicdkrgyktahiaadgsvfnrypgykekaaqal
    kdiynwdvekmedhpiqlvaaedgsgvgaaiiacltqkrlaagksvgikge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o08B (B:)
    mvrlgpkkpparkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkg
    gnipmipgwvveyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrt
    gtseqlwsfiakclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdie
    gveghdvvpmlqeqieklnipinvvalindttgtlvaslytdpqtkmgiiigtgvngayy
    dvvsgieklegllpedigpdspmainceygsfdnehlvlprtkydviideesprpgqqaf
    ekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdtsypskieddpfenledt
    ddlfktnlniettvverklirklaelvgtraarltvcgvsaicdkrgyktahiaadgsvf
    nrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvgaaiiacltqkrlaagksv
    gikge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o08B (B:)
    kkpparkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkggnipmi
    pgwvveyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtgtseql
    wsfiakclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdiegveghd
    vvpmlqeqieklnipinvvalindttgtlvaslytdpqtkmgiiigtgvngayydvvsgi
    eklegllpedigpdspmainceygsfdnehlvlprtkydviideesprpgqqafekmtsg
    yylgeimrlvlldlydsgfifkdqdisklkeayvmdtsypskieddpfenledtddlfkt
    nlniettvverklirklaelvgtraarltvcgvsaicdkrgyktahiaadgsvfnrypgy
    kekaaqalkdiynwdvekmedhpiqlvaaedgsgvgaaiiacltqkrlaagksvgikge