PDB entry 3o07

View 3o07 on RCSB PDB site
Description: Crystal structure of yeast pyridoxal 5-phosphate synthase Snz1 complexed with substrate G3P
Class: biosynthetic protein
Keywords: (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3P R5P Sno1, BIOSYNTHETIC PROTEIN
Deposited on 2010-07-19, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o07a_
  • Chain 'B':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o07b_
  • Chain 'C':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o07c_
  • Heterogens: G3H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o07A (A:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o07A (A:)
    lkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvsi
    pvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgeal
    rrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvsl
    lkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavveat
    thfdnpskllevssdlgel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o07B (B:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o07B (B:)
    lkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvsi
    pvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgeal
    rrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvsl
    lkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavveat
    thfdnpskllevssdlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o07C (C:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o07C (C:)
    lkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvsi
    pvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgeal
    rrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvsl
    lkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavveat
    thfdnpskllevssdlgel