PDB entry 3o06

View 3o06 on RCSB PDB site
Description: Crystal Structure of yeast pyridoxal 5-phosphate synthase Snz1
Class: biosynthetic protein
Keywords: (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP Sno1 G3P R5P, BIOSYNTHETIC PROTEIN
Deposited on 2010-07-19, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o06a_
  • Chain 'B':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o06b_
  • Chain 'C':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o06c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o06A (A:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o06A (A:)
    lkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvsi
    pvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgeal
    rrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvsl
    lkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavveat
    thfdnpskllevssdlge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o06B (B:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o06B (B:)
    lkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvsi
    pvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgeal
    rrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvsl
    lkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavveat
    thfdnpskllevssdlge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o06C (C:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o06C (C:)
    lkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvsi
    pvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgeal
    rrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvsl
    lkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavveat
    thfdnpskllevssdlge