PDB entry 3o05

View 3o05 on RCSB PDB site
Description: Crystal Structure of Yeast Pyridoxal 5-Phosphate Synthase Snz1 Complxed with Substrate PLP
Class: biosynthetic protein
Keywords: beta slash alpha barrel, (beat/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3P RBP Sno1, BIOSYNTHETIC PROTEIN
Deposited on 2010-07-19, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o05a_
  • Chain 'B':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o05b_
  • Chain 'C':
    Compound: Pyridoxine biosynthesis protein SNZ1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SNZ1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o05c_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o05A (A:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o05A (A:)
    mlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvs
    ipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgea
    lrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvs
    llkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavvea
    tthfdnpskllevssdlgelm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3o05B (B:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o05B (B:)
    mlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvs
    ipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgea
    lrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvs
    llkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavvea
    tthfdnpskllevssdlgelm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3o05C (C:)
    mhhhhhhgmlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmi
    kdimnsvsipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvc
    gakdlgealrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakva
    eemrvpvsllkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvr
    latavveatthfdnpskllevssdlgelmggvsiesishasngvrlseigw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o05C (C:)
    mlkggvimdvvtpeqakiaeksgacavmalesipadmrksgkvcrmsdpkmikdimnsvs
    ipvmakvrighfveaqiiealevdyidesevltpadwthhiekdkfkvpfvcgakdlgea
    lrrinegaamirtkgeagtgdvseavkhirriteeikacqqlkseddiakvaeemrvpvs
    llkdvlekgklpvvnfaaggvatpadaallmqlgcdgvfvgsgifkssnpvrlatavvea
    tthfdnpskllevssdlgelm