PDB entry 3o04

View 3o04 on RCSB PDB site
Description: Crystal structure of the beta-keto-acyl carrier protein synthase II (lmo2201) from Listeria monocytogenes
Class: transferase
Keywords: CSGID, Structural Genomics, Center for Structural Genomics of Infectious Diseases, 3-layer(aba) sandwich, acyltransferase, TRANSFERASE
Deposited on 2010-07-19, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.152
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-keto-acyl carrier protein synthase II
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: lmo2201
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y574 (0-412)
      • engineered (10)
    Domains in SCOPe 2.07: d3o04a1, d3o04a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o04A (A:)
    mdkrrvvvtgigavtpigndaetswenakkgvngvakmtrlnpddfpvkiaaelkdfdve
    kylekkearkmdrfthyaiasaemavqdsglviddsnanrvgvwigsgiggmetfetqye
    iflnrghrrvspffvpmmipdmgsgqvsirfgakginsttvtacatatnsigdafkvier
    gdadamitggaeapitkmslagftankalslnpdpetacrpfdkdrdgfiigegagivil
    eeyehakargakiyaeivgygatgdayhitapapngegaaramkmaiddagltpdkvdyi
    nahgtstpyndeyetqaiktvfgehakklaisstksmtghtlgasggieaifalltirdn
    iiaptihlknqdevcdldyvpneareanvnvvisnsfgfgghnatlvfkried