PDB entry 3o03

View 3o03 on RCSB PDB site
Description: Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2
Class: oxidoreductase
Keywords: rossmann fold, oxidoreductase
Deposited on 2010-07-18, released 2010-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehydrogenase with different specificities
    Species: Streptococcus suis [TaxId:391295]
    Gene: IDNO, SSU05_1225
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3o03a_
  • Heterogens: CA, NAP, GCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o03A (A:)
    mgsshhhhhhssglvprgshmnqqfsldqfslkgkialvtgasygigfaiasayakagat
    ivfndinqelvdrgmaaykaaginahgyvcdvtdedgiqamvaqiesevgiidilvnnag
    iirrvpmiemtaaqfrqvididlnapfivskavipsmikkghgkiinicsmmselgretv
    sayaaakgglkmltkniaseygeaniqcngigpgyiatpqtaplrelqkdgsrhpfdqfi
    iaktpaarwgeaedlmgpavflasdasnfvnghilyvdggilayigkqpea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o03A (A:)
    qfsldqfslkgkialvtgasygigfaiasayakagativfndinqelvdrgmaaykaagi
    nahgyvcdvtdedgiqamvaqiesevgiidilvnnagiirrvpmiemtaaqfrqvididl
    napfivskavipsmikkghgkiinicsmmselgretvsayaaakgglkmltkniaseyge
    aniqcngigpgyiatpqthpfdqfiiaktpaarwgeaedlmgpavflasdasnfvnghil
    yvdggilayigkqp