PDB entry 3o01

View 3o01 on RCSB PDB site
Description: The Crystal Structure of the Salmonella Type III Secretion System Tip Protein SipD in Complex with Deoxycholate
Deposited on 2010-07-18, released 2010-11-17
The last revision was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell invasion protein sipD
    Species: Salmonella enterica [TaxId:90371]
    Gene: sipD, sspD, STM2883
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56026 (3-End)
      • expression tag (0-2)
      • engineered mutation (208)
  • Chain 'B':
    Compound: Cell invasion protein sipD
    Species: Salmonella enterica [TaxId:90371]
    Gene: sipD, sspD, STM2883
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56026
      • engineered mutation (208)
  • Heterogens: NI, DXC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3o01A (A:)
    ghmehrgtdiislsqaatkihqaqqtlqstppiseenndertlarqqltsslnalaksgv
    slsaeqnenlrsafsaptsalfsaspmaqprttisdaeiwdmvsqnisaigdsylgvyen
    vvavytdfyqafsdilskmggwllpgkdgntvkldvtslkndlnslvnkynqinsntvlf
    paqsgsgvkvateaearqwlselnlpnsslksygsgyvvtvdltplqkmvqdidglgapg
    kdsklemdnakyqawqsgfkaqeenmkttlqtltqkysnanslydnlvkvlsstisssle
    taksflqg
    

    Sequence, based on observed residues (ATOM records):
    >3o01A (A:)
    ghmehrgtdiislsqaatkihqaqqtlqstppiseenndertlarqqltsslnalaksgv
    slsaeqnenlrsafiwdmvsqnisaigdsylgvyenvvavytdfyqafsdilskmggwll
    pgkdgntvkldvtslkndlnslvnkynqinsntvlfpaqsgsgvkvateaearqwlseln
    lpnsslksygsgyvvtvdltplqkmvqdidglgapgkdsklemdnakyqawqsgfkaqee
    nmkttlqtltqkysnanslydnlvkvlsstisssletaksflq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3o01B (B:)
    ghmehrgtdiislsqaatkihqaqqtlqstppiseenndertlarqqltsslnalaksgv
    slsaeqnenlrsafsaptsalfsaspmaqprttisdaeiwdmvsqnisaigdsylgvyen
    vvavytdfyqafsdilskmggwllpgkdgntvkldvtslkndlnslvnkynqinsntvlf
    paqsgsgvkvateaearqwlselnlpnsslksygsgyvvtvdltplqkmvqdidglgapg
    kdsklemdnakyqawqsgfkaqeenmkttlqtltqkysnanslydnlvkvlsstisssle
    taksflqg
    

    Sequence, based on observed residues (ATOM records):
    >3o01B (B:)
    gtdiislsqaatkihqaqqtlqstppiseenndertlarqqltsslnalaksgvslsaeq
    nenlrsafsaptsalfsiwdmvsqnisaigdsylgvyenvvavytdfyqafsdilskmgg
    wllpgkdgntvkldvtslkndlnslvnkynqinsntvlfpaqsgvkvateaearqwlsel
    nlpnsslksygsgyvvtvdltplqkmvqdidglgapgkdsklemdnakyqawqsgfkaqe
    enmkttlqtltqkysnanslydnlvkvlsstisssletak