PDB entry 3nzy

View 3nzy on RCSB PDB site
Description: Crystal structure of extracellular domains of mouse RANK-RANKL complex
Class: cytokine/cytokine receptor
Keywords: tumor necrosis factor (TNF) ligand-receptor superfamily fold, signaling cytokines, CYTOKINE-CYTOKINE RECEPTOR complex
Deposited on 2010-07-17, released 2010-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor ligand superfamily member 11
    Species: Mus musculus [TaxId:10090]
    Gene: RANKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3nzya_
  • Chain 'B':
    Compound: Tumor necrosis factor receptor superfamily member 11A
    Species: Mus musculus [TaxId:10090]
    Gene: RANK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35305 (0-163)
      • conflict (106)
      • conflict (163)
  • Chain 'C':
    Compound: tumor necrosis factor ligand superfamily member 11
    Species: Mus musculus [TaxId:10090]
    Gene: RANKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3nzyc_
  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 11A
    Species: Mus musculus [TaxId:10090]
    Gene: RANK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35305 (0-163)
      • conflict (106)
      • conflict (163)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nzyA (A:)
    aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
    frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
    klrageeisiqvsnpslldpdqdatyfgafkvqdi
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nzyC (C:)
    aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
    frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
    klrageeisiqvsnpslldpdqdatyfgafkvqdi
    

  • Chain 'D':
    No sequence available.