PDB entry 3nzt

View 3nzt on RCSB PDB site
Description: 2.0 angstrom crystal structure of glutamate--cysteine ligase (gsha) ftom francisella tularensis in complex with amp
Deposited on 2010-07-16, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate--cysteine ligase
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0367c, gshA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nztA (A:)
    mhhhhhhssgvdlgtenlyfqsnamydfkkinnlrgieretlrvtdcgnlatsnhpdglg
    hkltnnsitvdfsenllelitkphdsidkaigelyqlsaftldnmhsdeiilntsmplsa
    ndndiqeadfgssnsgrmkrvyrkglsarygkimqiisgihynfsfdkdlisniatnkqv
    sisdiyfdvlnnyfefmwllpylfgaspicaktsvknkpdylsvlddkfyvgeyatslrm
    sdlgytspaqkdlaisydnvkayvkdliqatddtfadykriglynsqgqriqlndgilqi
    eneyysairpkqiakrgerpacalynrgveyvevrvldvdpfepvgiskdtalfvevmlm
    tcldkdakkyhkdiikqakqnltavaiqgrnpqlklkkldddseillkdyalelfdeiea
    vakkmpkeyldaveiqkrkvldisqtpsakiielarqhgykkfildisrrvsqqfrsyel
    paaivaklkdqagqsvaaekelvandkisldeyinryyksskgcc
    

    Sequence, based on observed residues (ATOM records):
    >3nztA (A:)
    ydfkkinnlrgieretlrvtdcgnlatsnhpdglghkltnnsitvdfsenllelitkphd
    sidkaigelyqlsaftldnmhsdeiilntsmplsandndiqeadfgssnsgrmkrvyrkg
    lsarygkimqiisgihynfsfdkdlisniatnkqvsisdiyfdvlnnyfefmwllpylfg
    aspicaktsvknkpdylsvlddkfyvgeyatslrmsdlgspaqkdlaisydnvkayvkdl
    iqatddtfadykriglynsqgqriqlndgilqieneyysairpkqiakrgerpacalynr
    gveyvevrvldvdpfepvgiskdtalfvevmlmtcldkdakkyhkdiikqakqnltavai
    qgrnpqlklkkldddseillkdyalelfdeieavakkmpkeyldaveiqkrkvldisqtp
    sakiielarqhgykkfildisrrvsqqfrsyelpaaivaklkdqagqsvaaekelvandk
    isldeyinryyksskgcc