PDB entry 3nzr

View 3nzr on RCSB PDB site
Description: Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase from Vibrio fischeri ES114
Deposited on 2010-07-16, released 2010-09-08
The last revision was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_2509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E1U2 (3-246)
      • expression tag (247)
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_2509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E1U2 (3-246)
      • expression tag (247)
  • Chain 'C':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_2509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E1U2 (3-246)
      • expression tag (247)
  • Chain 'D':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_2509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5E1U2 (3-246)
      • expression tag (247)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nzrA (A:)
    snaslkanfyknrvclnvlagsvdnaadiydaaeghvlvgvlsknypdvdtavedmkkys
    evtnnavsvglgagdpnqsmmvslisqhvqpqhinqvftgvatsralagqdksivnglis
    ptgtvgmvkistgplssrsedaivpvetaiamlkdmggssvkyfpmggletreefacvak
    acadkdfwleptggidlenyeeimqialdagvskiiphiyssiidkatgntrpedvktll
    dmtkklll
    

    Sequence, based on observed residues (ATOM records):
    >3nzrA (A:)
    slkanfyknrvclnvlagsvdnaadiydaaeghvlvgvlsknypdvdtavedmkkysevt
    nnavsvglgagdpnqsmmvslisqhvqpqhinqvftgvatsralagqdksivnglisptg
    tvgmvkistgplssrsedaivpvetaiamlkdmggssvkyfpmggletreefacvakaca
    dkdfwleptggidlenyeeimqialdagvskiiphiyssiidkatgntrpedvktlldmt
    kklll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nzrB (B:)
    snaslkanfyknrvclnvlagsvdnaadiydaaeghvlvgvlsknypdvdtavedmkkys
    evtnnavsvglgagdpnqsmmvslisqhvqpqhinqvftgvatsralagqdksivnglis
    ptgtvgmvkistgplssrsedaivpvetaiamlkdmggssvkyfpmggletreefacvak
    acadkdfwleptggidlenyeeimqialdagvskiiphiyssiidkatgntrpedvktll
    dmtkklll
    

    Sequence, based on observed residues (ATOM records):
    >3nzrB (B:)
    slkanfyknrvclnvlagsvdnaadiydaaeghvlvgvlsknypdvdtavedmkkysevt
    nnavsvglgagdpnqsmmvslisqhvqpqhinqvftgvatsralagqdksivnglisptg
    tvgmvkistgplssrsedaivpvetaiamlkdmggssvkyfpmggletreefacvakaca
    dkdfwleptggidlenyeeimqialdagvskiiphiyssiidkatgntrpedvktlldmt
    kklll
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nzrC (C:)
    snaslkanfyknrvclnvlagsvdnaadiydaaeghvlvgvlsknypdvdtavedmkkys
    evtnnavsvglgagdpnqsmmvslisqhvqpqhinqvftgvatsralagqdksivnglis
    ptgtvgmvkistgplssrsedaivpvetaiamlkdmggssvkyfpmggletreefacvak
    acadkdfwleptggidlenyeeimqialdagvskiiphiyssiidkatgntrpedvktll
    dmtkklll
    

    Sequence, based on observed residues (ATOM records):
    >3nzrC (C:)
    slkanfyknrvclnvlagsvdnaadiydaaeghvlvgvlsknypdvdtavedmkkysevt
    nnavsvglgagdpnqsmmvslisqhvqpqhinqvftgvatsralagqdksivnglisptg
    tvgmvkistgplssrsedaivpvetaiamlkdmggssvkyfpmggletreefacvakaca
    dkdfwleptggidlenyeeimqialdagvskiiphiyssiidkatgntrpedvktlldmt
    kklll
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nzrD (D:)
    snaslkanfyknrvclnvlagsvdnaadiydaaeghvlvgvlsknypdvdtavedmkkys
    evtnnavsvglgagdpnqsmmvslisqhvqpqhinqvftgvatsralagqdksivnglis
    ptgtvgmvkistgplssrsedaivpvetaiamlkdmggssvkyfpmggletreefacvak
    acadkdfwleptggidlenyeeimqialdagvskiiphiyssiidkatgntrpedvktll
    dmtkklll
    

    Sequence, based on observed residues (ATOM records):
    >3nzrD (D:)
    slkanfyknrvclnvlagsvdnaadiydaaeghvlvgvlsknypdvdtavedmkkysevt
    nnavsvglgagdpnqsmmvslisqhvqpqhinqvftgvatsralagqdksivnglisptg
    tvgmvkistgplssrsedaivpvetaiamlkdmggssvkyfpmggletreefacvakaca
    dkdfwleptggidlenyeeimqialdagvskiiphiyssiidkatgntrpedvktlldmt
    kklll