PDB entry 3nzq

View 3nzq on RCSB PDB site
Description: Crystal Structure of Biosynthetic arginine decarboxylase ADC (SpeA) from Escherichia coli, Northeast Structural Genomics Consortium Target ER600
Deposited on 2010-07-16, released 2010-09-01
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biosynthetic arginine decarboxylase
    Species: Escherichia coli [TaxId:83333]
    Gene: b2938, JW2905, speA, speA (b2938)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21170 (Start-657)
      • expression tag (658-660)
  • Chain 'B':
    Compound: Biosynthetic arginine decarboxylase
    Species: Escherichia coli [TaxId:83333]
    Gene: b2938, JW2905, speA, speA (b2938)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21170 (Start-657)
      • expression tag (658-660)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nzqA (A:)
    msddmsmglpssagehgvlrsmqevamssqeaskmlrtyniawwgnnyydvnelghisvc
    pdpdvpearvdlaqlvktreaqgqrlpalfcfpqilqhrlrsinaafkraresygyngdy
    flvypikvnqhrrvieslihsgeplgleagskaelmavlahagmtrsvivcngykdreyi
    rlaligekmghkvylviekmseiaivldeaerlnvvprlgvrarlasqgsgkwqssggek
    skfglaatqvlqlvetlreagrldslqllhfhlgsqmanirdiatgvresarfyvelhkl
    gvniqcfdvggglgvdyegtrsqsdcsvnyglneyanniiwaigdaceenglphptvite
    sgravtahhtvlvsniigverneytvptapaedapralqsmwetwqemhepgtrrslrew
    lhdsqmdlhdihigyssgifslqerawaeqlylsmchevqkqldpqnrahrpiidelqer
    madkmyvnfslfqsmpdawgidqlfpvlplegldqvperravllditcdsdgaidhyidg
    dgiattmpmpeydpenppmlgffmvgayqeilgnmhnlfgdteavdvfvfpdgsvevels
    degdtvadmlqyvqldpktlltqfrdqvkktdldaelqqqfleefeaglygytyledele
    hhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nzqA (A:)
    kmlrtyniawwgnnyydvnelghisvcpdpdvpearvdlaqlvktreaqgqrlpalfcfp
    qilqhrlrsinaafkraresygyngdyflvypikvnqhrrvieslihsgeplgleagska
    elmavlahagmtrsvivcngykdreyirlaligekmghkvylviekmseiaivldeaerl
    nvvprlgvrarlasqgsgkwqssggekskfglaatqvlqlvetlreagrldslqllhfhl
    gsqmanirdiatgvresarfyvelhklgvniqcfdvggglgvdyegtrsqsdcsvnygln
    eyanniiwaigdaceenglphptvitesgravtahhtvlvsniigverneytvptapaed
    apralqsmwetwqemhepgtrrslrewlhdsqmdlhdihigyssgifslqerawaeqlyl
    smchevqkqldpqnrahrpiidelqermadkmyvnfslfqsmpdawgidqlfpvlplegl
    dqvperravllditcdsdgaidhyidgdgiattmpmpeydpenppmlgffmvgayqeilg
    nmhnlfgdteavdvfvfpdgsvevelsdegdtvadmlqyvqldpktlltqfrdqvkktdl
    daelqqqfleefeaglygytyledeleh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nzqB (B:)
    msddmsmglpssagehgvlrsmqevamssqeaskmlrtyniawwgnnyydvnelghisvc
    pdpdvpearvdlaqlvktreaqgqrlpalfcfpqilqhrlrsinaafkraresygyngdy
    flvypikvnqhrrvieslihsgeplgleagskaelmavlahagmtrsvivcngykdreyi
    rlaligekmghkvylviekmseiaivldeaerlnvvprlgvrarlasqgsgkwqssggek
    skfglaatqvlqlvetlreagrldslqllhfhlgsqmanirdiatgvresarfyvelhkl
    gvniqcfdvggglgvdyegtrsqsdcsvnyglneyanniiwaigdaceenglphptvite
    sgravtahhtvlvsniigverneytvptapaedapralqsmwetwqemhepgtrrslrew
    lhdsqmdlhdihigyssgifslqerawaeqlylsmchevqkqldpqnrahrpiidelqer
    madkmyvnfslfqsmpdawgidqlfpvlplegldqvperravllditcdsdgaidhyidg
    dgiattmpmpeydpenppmlgffmvgayqeilgnmhnlfgdteavdvfvfpdgsvevels
    degdtvadmlqyvqldpktlltqfrdqvkktdldaelqqqfleefeaglygytyledele
    hhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nzqB (B:)
    kmlrtyniawwgnnyydvnelghisvcpdpdvpearvdlaqlvktreaqgqrlpalfcfp
    qilqhrlrsinaafkraresygyngdyflvypikvnqhrrvieslihsgeplgleagska
    elmavlahagmtrsvivcngykdreyirlaligekmghkvylviekmseiaivldeaerl
    nvvprlgvrarlasqgsgkwqssggekskfglaatqvlqlvetlreagrldslqllhfhl
    gsqmanirdiatgvresarfyvelhklgvniqcfdvggglgvdyegtrsqsdcsvnygln
    eyanniiwaigdaceenglphptvitesgravtahhtvlvsniigverneytvptapaed
    apralqsmwetwqemhepgtrrslrewlhdsqmdlhdihigyssgifslqerawaeqlyl
    smchevqkqldpqnrahrpiidelqermadkmyvnfslfqsmpdawgidqlfpvlplegl
    dqvperravllditcdsdgaidhyidgdgiattmpmpeydpenppmlgffmvgayqeilg
    nmhnlfgdteavdvfvfpdgsvevelsdegdtvadmlqyvqldpktlltqfrdqvkktdl
    daelqqqfleefeaglygytyledeleh