PDB entry 3nzp

View 3nzp on RCSB PDB site
Description: Crystal Structure of the Biosynthetic Arginine decarboxylase SpeA from Campylobacter jejuni, Northeast Structural Genomics Consortium Target BR53
Deposited on 2010-07-16, released 2010-09-01
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.18
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine decarboxylase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0764c, speA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Arginine decarboxylase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0764c, speA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PAC6 (0-610)
      • expression tag (611-618)
  • Heterogens: PLP, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nzpA (A:)
    mmdygidiwgnenfiikngkvcinyekkpaiidivkelrddgykgplllrfphliqkqie
    niygnfnkarkefgykggfnavyplkvnqypgfvknlvklgkdynygleagskaelllam
    aynnegapitvngfkdrelinigfiaaemghnitltieglneleaiidiakerfkpkpni
    glrvrlhsagvgiwaksgginskfgltstelieavnllkenklleqftmihfhlgsqite
    ihplkkalneagniytelrkmgaknlkainlggglaveysqfkneksrnytlreyandvv
    filkniaeqkkdlepdifiesgrfvaanhavliapvlelfsqeyaenklilkkqnpklid
    elydlyksikpsnaleylhdsidhlesiltlfdlgyvdlqdrsnaeilthlitkkailll
    gdkqnpadllaiqdevqerylvnfslfqsmpdfwgleqnfpimpldrldeeptrsasiwd
    itcdsdgeisyskdkplflhdvdvekenyflgfflvgayqevlgmkhnlfthpteaiisi
    nekgyevegiieaqsildtledldydihaimdilnerisnsklvndkqkkhilgelylfl
    ndngylksigvlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nzpA (A:)
    mmdygidiwgnenfiikngkvcinyekkpaiidivkelrddgykgplllrfphliqkqie
    niygnfnkarkefgykggfnavyplkvnqypgfvknlvklgkdynygleagskaelllam
    aynnegapitvngfkdrelinigfiaaemghnitltieglneleaiidiakerfkpkpni
    glrvrlhsakfgltstelieavnllkenklleqftmihfhlgsqiteihplkkalneagn
    iytelrkmgaknlkainlggglaveysqfkneksrnytlreyandvvfilkniaeqkkdl
    epdifiesgrfvaanhavliapvlelfsqeyaenklilkkqnpklidelydlyksikpsn
    aleylhdsidhlesiltlfdlgyvdlqdrsnaeilthlitkkailllgevqerylvnfsl
    fqsmpdfwgleqnfpimpldrldeeptrsasiwditcdsdgeisyskdkplflhdvdvek
    enyflgfflvgayqevlgmkhnlfthpteaiisinekgyevegiieaqsildtledldyd
    ihaimdilnerisnsklvndkqkkhilgelylflndngylksi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nzpB (B:)
    mmdygidiwgnenfiikngkvcinyekkpaiidivkelrddgykgplllrfphliqkqie
    niygnfnkarkefgykggfnavyplkvnqypgfvknlvklgkdynygleagskaelllam
    aynnegapitvngfkdrelinigfiaaemghnitltieglneleaiidiakerfkpkpni
    glrvrlhsagvgiwaksgginskfgltstelieavnllkenklleqftmihfhlgsqite
    ihplkkalneagniytelrkmgaknlkainlggglaveysqfkneksrnytlreyandvv
    filkniaeqkkdlepdifiesgrfvaanhavliapvlelfsqeyaenklilkkqnpklid
    elydlyksikpsnaleylhdsidhlesiltlfdlgyvdlqdrsnaeilthlitkkailll
    gdkqnpadllaiqdevqerylvnfslfqsmpdfwgleqnfpimpldrldeeptrsasiwd
    itcdsdgeisyskdkplflhdvdvekenyflgfflvgayqevlgmkhnlfthpteaiisi
    nekgyevegiieaqsildtledldydihaimdilnerisnsklvndkqkkhilgelylfl
    ndngylksigvlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nzpB (B:)
    mmdygidiwgnenfiikngkvcinyekkpaiidivkelrddgykgplllrfphliqkqie
    niygnfnkarkefgykggfnavyplkvnqypgfvknlvklgkdynygleagskaelllam
    aynnegapitvngfkdrelinigfiaaemghnitltieglneleaiidiakerfkpkpni
    glrvrlhskfgltstelieavnllkenklleqftmihfhlgsqiteihplkkalneagni
    ytelrkmgaknlkainlggglaveysqfkneksrnytlreyandvvfilkniaeqkkdle
    pdifiesgrfvaanhavliapvlelfsqeyaenklilkkqnpklidelydlyksikpsna
    leylhdsidhlesiltlfdlgyvdlqdrsnaeilthlitkkailllgvqerylvnfslfq
    smpdfwgleqnfpimpldrldeeptrsasiwditcdsdgeisyskdkplflhdvdveken
    yflgfflvgayqevlgmkhnlfthpteaiisinekgyevegiieaqsildtledldydih
    aimdilnerisnsklvndkqkkhilgelylflndngylksigvlehhhhhh