PDB entry 3nzo

View 3nzo on RCSB PDB site
Description: UDP-N-acetylglucosamine 4,6-dehydratase from Vibrio fischeri.
Deposited on 2010-07-16, released 2010-07-28
The last revision was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylglucosamine 4,6-dehydratase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_0140
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: UDP-N-acetylglucosamine 4,6-dehydratase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_0140
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: UDP-N-acetylglucosamine 4,6-dehydratase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_0140
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: UDP-N-acetylglucosamine 4,6-dehydratase
    Species: Vibrio fischeri [TaxId:312309]
    Gene: VF_0140
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, SCN, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nzoA (A:)
    snamnsilsligrdtelfhqdinanekelqsvvsqsrflvlggagsigqavtkeifkrnp
    qklhvvdisennmvelvrdirssfgyingdfqtfaldigsieydafikadgqydyvlnls
    alkhvrsekdpftlmrmidvnvfntdktiqqsidagakkyfcvstdkaanpvnmmgaskr
    imemflmrkseeiaistarfanvafsdgsllhgfnqriqknqpivapndikryfvtpqes
    gelclmscifgenrdiffpklsealhlisfadiavkylkqlgyephlcesedearelakt
    lpaqgkwpclftssdttgekdfeefftdketldmarfdnlgiikndslyqqellelfeqk
    igqmktdrqwtkeeivqlffimipdfghketgkyldskm
    

    Sequence, based on observed residues (ATOM records):
    >3nzoA (A:)
    silsligrdtelfhqdinanekelqsvvsqsrflvlggagsigqavtkeifkrnpqklhv
    vdisennmvelvrdirssfgyingdfqtfaldigsieydafikadgqydyvlnlsalkhv
    rsekdpftlmrmidvnvfntdktiqqsidagakkyfcvstdkaanpvnmmgaskrimemf
    lmrkseeiaistarfanvafsdgsllhgfnqriqknqpivapndikryfvtpqesgelcl
    mscifgenrdiffpklsealhlisfadiavkylkqlgyephlcesedearelaktlpaqg
    kwpclftssefftdketldmarfdnlgiikndslyqqellelfeqkigqmktdrqwtkee
    ivqlffimipdf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nzoB (B:)
    snamnsilsligrdtelfhqdinanekelqsvvsqsrflvlggagsigqavtkeifkrnp
    qklhvvdisennmvelvrdirssfgyingdfqtfaldigsieydafikadgqydyvlnls
    alkhvrsekdpftlmrmidvnvfntdktiqqsidagakkyfcvstdkaanpvnmmgaskr
    imemflmrkseeiaistarfanvafsdgsllhgfnqriqknqpivapndikryfvtpqes
    gelclmscifgenrdiffpklsealhlisfadiavkylkqlgyephlcesedearelakt
    lpaqgkwpclftssdttgekdfeefftdketldmarfdnlgiikndslyqqellelfeqk
    igqmktdrqwtkeeivqlffimipdfghketgkyldskm
    

    Sequence, based on observed residues (ATOM records):
    >3nzoB (B:)
    lsligrdtelfhqdinanekelqsvvsqsrflvlggagsigqavtkeifkrnpqklhvvd
    isennmvelvrdirssfgyingdfqtfaldigsieydafikadgqydyvlnlsalkhvrs
    ekdpftlmrmidvnvfntdktiqqsidagakkyfcvstdkaanpvnmmgaskrimemflm
    rkseeiaistarfanvafsdgsriqknqpikryfvtpqesgelclmscifgenrdiffpk
    dmarfdnlgiiknyqqellelfeqkigqmktdrqwtkeeivqlffimipdfghketgkyl
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nzoC (C:)
    snamnsilsligrdtelfhqdinanekelqsvvsqsrflvlggagsigqavtkeifkrnp
    qklhvvdisennmvelvrdirssfgyingdfqtfaldigsieydafikadgqydyvlnls
    alkhvrsekdpftlmrmidvnvfntdktiqqsidagakkyfcvstdkaanpvnmmgaskr
    imemflmrkseeiaistarfanvafsdgsllhgfnqriqknqpivapndikryfvtpqes
    gelclmscifgenrdiffpklsealhlisfadiavkylkqlgyephlcesedearelakt
    lpaqgkwpclftssdttgekdfeefftdketldmarfdnlgiikndslyqqellelfeqk
    igqmktdrqwtkeeivqlffimipdfghketgkyldskm
    

    Sequence, based on observed residues (ATOM records):
    >3nzoC (C:)
    silsligrdtelfhqdinanekelqsvvsqsrflvlggagsigqavtkeifkrnpqklhv
    vdisennmvelvrdirssfgyingdfqtfaldigsieydafikadgqydyvlnlsalkhv
    rsekdpftlmrmidvnvfntdktiqqsidagakkyfcvstdkaanpvnmmgaskrimemf
    lmrkseeiaistarfanvafsdgsllhgfnqriqknqpivapndikryfvtpqesgelcl
    mscifgenrdiffpklsealhlisfadiavkylkqlgyephlcesedearelaktlpaqg
    kwpclftssefftdketldmarfdnlgiiknlyqqellelfeqkigqmktdrqwtkeeiv
    qlffimipdfg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nzoD (D:)
    snamnsilsligrdtelfhqdinanekelqsvvsqsrflvlggagsigqavtkeifkrnp
    qklhvvdisennmvelvrdirssfgyingdfqtfaldigsieydafikadgqydyvlnls
    alkhvrsekdpftlmrmidvnvfntdktiqqsidagakkyfcvstdkaanpvnmmgaskr
    imemflmrkseeiaistarfanvafsdgsllhgfnqriqknqpivapndikryfvtpqes
    gelclmscifgenrdiffpklsealhlisfadiavkylkqlgyephlcesedearelakt
    lpaqgkwpclftssdttgekdfeefftdketldmarfdnlgiikndslyqqellelfeqk
    igqmktdrqwtkeeivqlffimipdfghketgkyldskm
    

    Sequence, based on observed residues (ATOM records):
    >3nzoD (D:)
    silsligrdtelfhqdinanekelqsvvsqsrflvlggagsigqavtkeifkrnpqklhv
    vdisennmvelvrdirssfgyingdfqtfaldigsieydafikadgqydyvlnlsalkhv
    rsekdpftlmrmidvnvfntdktiqqsidagakkyfcvstdkaanpvnmmgaskrimemf
    lmrkseeiaistarfanvafsdgsllhgfnqriqknqpivapndikryfvtpqesgelcl
    mscifgenrdiffpklsealhlisfadiavkylkqlgyephlcesedearelaktlpaqg
    kwpclftssdtefftdketldmarfdnlgiiknyqqellelfeqkigqmktdrqwtkeei
    vqlffimipdf