PDB entry 3nzn

View 3nzn on RCSB PDB site
Description: The crystal structure of the Glutaredoxin from Methanosarcina mazei Go1
Deposited on 2010-07-16, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.149
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: MM_3271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PS17 (4-102)
      • expression tag (0-3)
  • Chain 'B':
    Compound: glutaredoxin
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: MM_3271
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PS17 (4-102)
      • expression tag (0-3)
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nznA (A:)
    snavnlfgqkdrgnhvsgvdrgkvimyglstcvwckktkklltdlgvdfdyvyvdrlegk
    eeeeaveevrrfnpsvsfpttiindekaivgfkekeireslgf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nznB (B:)
    snavnlfgqkdrgnhvsgvdrgkvimyglstcvwckktkklltdlgvdfdyvyvdrlegk
    eeeeaveevrrfnpsvsfpttiindekaivgfkekeireslgf