PDB entry 3nzm

View 3nzm on RCSB PDB site
Description: Crystal structure of DNAE intein with N-extein in redox trap
Class: transferase
Keywords: disulfide bond, TRANSFERASE
Deposited on 2010-07-16, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.22
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III subunit alpha
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: dnaE-N, slr0603, dnaE-C, sll1572
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74750 (5-167)
      • engineered mutation (4)
      • engineered mutation (6-8)
    Domains in SCOPe 2.07: d3nzma_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nzmA (A:)
    kspdpfcpgclsfgteiltveygplpigkivseeincsvysvdpegrvytqaiaqwhdrg
    eqevleyeledgsviratsdhrflttdyqllaieeifarqldlltlenikqteealdnhr
    lpfplldagtikmvkvigrrslgvqrifdiglpqdhnfllangaiaax
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nzmA (A:)
    pfcpgclsfgteiltveygplpigkivseeincsvysvdpegrvytqaiaqwhdrgeqev
    leyeledgsviratsdhrflttdyqllaieeifarqldlltlenikqteealdnhrlpfp
    lldagtikmvkvigrrslgvqrifdiglpqdhnfllangaiaax