PDB entry 3nzl

View 3nzl on RCSB PDB site
Description: Crystal Structure of the N-terminal domain of DNA-binding protein SATB1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4435B
Deposited on 2010-07-16, released 2010-09-22
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.15
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein SATB1
    Species: Homo sapiens [TaxId:9606]
    Gene: SATB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01826 (11-End)
      • expression tag (6-10)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nzlA (A:)
    mghhhhhhshmlppeqwshttvrnalkdllkdmnqsslakecplsqsmissivnstyyan
    vsaakcqefgrwykhfkktkdmm
    

    Sequence, based on observed residues (ATOM records):
    >3nzlA (A:)
    hhshmlppeqwshttvrnalkdllkdmnqsslakecplsqsmissivnstyyanvsaakc
    qefgrwykhfkkt