PDB entry 3nzk

View 3nzk on RCSB PDB site
Description: Structure of LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor
Deposited on 2010-07-16, released 2011-01-05
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: lpxC, YE0678
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: lpxC, YE0678
    Database cross-references and differences (RAF-indexed):
  • Heterogens: C90, ZN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nzkA (A:)
    mrdktmikqrtlkrivqatgvglhtgkkvtltmrpapantgviyrrtdlnppvdfpadak
    svrdtmlctclvnehdvristvehlnaalaglgidniiievnapevpimdgsaspfvyll
    ldagieelnsakkflrlketvrvedgdkwaelspfngfrldftidfnhpaidsstqryrl
    dfsadsfvrqisrartfgfmrdieylqsrglclggsfdcaivvddyrvlnedglrfedef
    vrhkmldaigdlfmcghniigaftayksghalnnkllqavlakqeawefvtfqdeaempl
    afkapstvlay
    

    Sequence, based on observed residues (ATOM records):
    >3nzkA (A:)
    mikqrtlkrivqatgvglhtgkkvtltmrpapantgviyrrtdlnppvdfpadaksvrdt
    mlctclvnehdvristvehlnaalaglgidniiievnapevpimdgsaspfvyllldagi
    eelnsakkflrlketvrvedgdkwaelspfngfrldftidfnhpaidsstqryrldfsad
    sfvrqisrartfgfmrdieylqsrglclggsfdcaivvddyrvlnedglrfedefvrhkm
    ldaigdlfmcghniigaftayksghalnnkllqavlakqeawefvtfqdeaemplafk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nzkB (B:)
    mrdktmikqrtlkrivqatgvglhtgkkvtltmrpapantgviyrrtdlnppvdfpadak
    svrdtmlctclvnehdvristvehlnaalaglgidniiievnapevpimdgsaspfvyll
    ldagieelnsakkflrlketvrvedgdkwaelspfngfrldftidfnhpaidsstqryrl
    dfsadsfvrqisrartfgfmrdieylqsrglclggsfdcaivvddyrvlnedglrfedef
    vrhkmldaigdlfmcghniigaftayksghalnnkllqavlakqeawefvtfqdeaempl
    afkapstvlay
    

    Sequence, based on observed residues (ATOM records):
    >3nzkB (B:)
    mikqrtlkrivqatgvglhtgkkvtltmrpapantgviyrrtdlnppvdfpadaksvrdt
    mlctclvnehdvristvehlnaalaglgidniiievnapevpimdgsaspfvyllldagi
    eelnsakkflrlketvrvedgdkwaelspfngfrldftidfnhpaidsstqryrldfsad
    sfvrqisrartfgfmrdieylqsrglclggsfdcaivvddyrvlnedglrfedefvrhkm
    ldaigdlfmcghniigaftayksghalnnkllqavlakqeawefvtfqdeaemplafkap